Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 173 (18 Sep 2019)
Sequence version 2 (13 Sep 2004)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Acetyl-CoA acetyltransferase, cytosolic

Gene

ACAT2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Involved in the biosynthetic pathway of cholesterol.1 Publication

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section describes the metabolic pathway(s) associated with a protein.<p><a href='/help/pathway' target='_top'>More...</a></p>Pathwayi: fatty acid metabolism

This protein is involved in the pathway fatty acid metabolism, which is part of Lipid metabolism.1 Publication
View all proteins of this organism that are known to be involved in the pathway fatty acid metabolism and in Lipid metabolism.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei92Acyl-thioester intermediate1 Publication1
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the interaction between a single amino acid and another chemical entity. Priority is given to the annotation of physiological ligands.<p><a href='/help/binding' target='_top'>More...</a></p>Binding sitei223Coenzyme ACombined sources1 Publication1
Binding sitei226Coenzyme ACombined sources1 Publication1
Binding sitei252Coenzyme A; via carbonyl oxygenCombined sources1 Publication1
<p>This subsection describes interesting single amino acid sites on the sequence that are not defined in any other subsection. This subsection can be displayed in different sections (‘Function’, ‘PTM / Processing’, ‘Pathology and Biotech’) according to its content.<p><a href='/help/site' target='_top'>More...</a></p>Sitei353Increases nucleophilicity of active site CysBy similarity1
Active sitei383Proton donor/acceptor1 Publication1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionAcyltransferase, Transferase

Enzyme and pathway databases

BioCyc Collection of Pathway/Genome Databases

More...
BioCyci
MetaCyc:ENSG00000120437-MONOMER

BRENDA Comprehensive Enzyme Information System

More...
BRENDAi
2.3.1.9 2681

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-191273 Cholesterol biosynthesis

UniPathway: a resource for the exploration and annotation of metabolic pathways

More...
UniPathwayi
UPA00199

Chemistry databases

SwissLipids knowledge resource for lipid biology

More...
SwissLipidsi
SLP:000001266

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Acetyl-CoA acetyltransferase, cytosolic (EC:2.3.1.9PROSITE-ProRule annotation1 Publication)
Alternative name(s):
Acetyl-CoA transferase-like protein
Cytosolic acetoacetyl-CoA thiolase
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:ACAT2
Synonyms:ACTL
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 6

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:94 ACAT2

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
100678 gene+phenotype

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q9BWD1

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
39

MalaCards human disease database

More...
MalaCardsi
ACAT2
MIMi100678 gene+phenotype

Open Targets

More...
OpenTargetsi
ENSG00000120437

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA19

Chemistry databases

Drug and drug target database

More...
DrugBanki
DB01992 Coenzyme A
DB01915 S-Hydroxycysteine

IUPHAR/BPS Guide to PHARMACOLOGY

More...
GuidetoPHARMACOLOGYi
2436

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
ACAT2

Domain mapping of disease mutations (DMDM)

More...
DMDMi
52000838

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002064091 – 397Acetyl-CoA acetyltransferase, cytosolicAdd BLAST397

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei1N-acetylmethionineCombined sources1
Modified residuei200N6-acetyllysineCombined sources1
Modified residuei233N6-acetyllysineCombined sources1
Modified residuei235N6-acetyllysineCombined sources1

Keywords - PTMi

Acetylation

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q9BWD1

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q9BWD1

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q9BWD1

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q9BWD1

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9BWD1

PeptideAtlas

More...
PeptideAtlasi
Q9BWD1

PRoteomics IDEntifications database

More...
PRIDEi
Q9BWD1

ProteomicsDB human proteome resource

More...
ProteomicsDBi
6403
79268 [Q9BWD1-1]

2D gel databases

USC-OGP 2-DE database

More...
OGPi
Q9BWD1

REPRODUCTION-2DPAGE

More...
REPRODUCTION-2DPAGEi
IPI00291419

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9BWD1

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9BWD1

SwissPalm database of S-palmitoylation events

More...
SwissPalmi
Q9BWD1

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000120437 Expressed in 225 organ(s), highest expression level in testis

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9BWD1 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
CAB021106
HPA025736
HPA025765
HPA025811

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Homotetramer.

1 Publication

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
106557, 41 interactors

Protein interaction database and analysis system

More...
IntActi
Q9BWD1, 7 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000356015

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1397
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q9BWD1

Database of comparative protein structure models

More...
ModBasei
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
Q9BWD1

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG1391 Eukaryota
COG0183 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00950000182771

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000012238

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9BWD1

KEGG Orthology (KO)

More...
KOi
K00626

Identification of Orthologs from Complete Genome Data

More...
OMAi
AWSCQMV

Database of Orthologous Groups

More...
OrthoDBi
1129049at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9BWD1

TreeFam database of animal gene trees

More...
TreeFami
TF300650

Family and domain databases

Conserved Domains Database

More...
CDDi
cd00751 thiolase, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
3.40.47.10, 2 hits

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR002155 Thiolase
IPR016039 Thiolase-like
IPR020610 Thiolase_AS
IPR020617 Thiolase_C
IPR020613 Thiolase_CS
IPR020616 Thiolase_N

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF02803 Thiolase_C, 1 hit
PF00108 Thiolase_N, 1 hit

PIRSF; a whole-protein classification database

More...
PIRSFi
PIRSF000429 Ac-CoA_Ac_transf, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF53901 SSF53901, 2 hits

TIGRFAMs; a protein family database

More...
TIGRFAMsi
TIGR01930 AcCoA-C-Actrans, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00737 THIOLASE_2, 1 hit
PS00099 THIOLASE_3, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: Q9BWD1-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MNAGSDPVVI VSAARTIIGS FNGALAAVPV QDLGSTVIKE VLKRATVAPE
60 70 80 90 100
DVSEVIFGHV LAAGCGQNPV RQASVGAGIP YSVPAWSCQM ICGSGLKAVC
110 120 130 140 150
LAVQSIGIGD SSIVVAGGME NMSKAPHLAY LRTGVKIGEM PLTDSILCDG
160 170 180 190 200
LTDAFHNCHM GITAENVAKK WQVSREDQDK VAVLSQNRTE NAQKAGHFDK
210 220 230 240 250
EIVPVLVSTR KGLIEVKTDE FPRHGSNIEA MSKLKPYFLT DGTGTVTPAN
260 270 280 290 300
ASGINDGAAA VVLMKKSEAD KRGLTPLARI VSWSQVGVEP SIMGIGPIPA
310 320 330 340 350
IKQAVTKAGW SLEDVDIFEI NEAFAAVSAA IVKELGLNPE KVNIEGGAIA
360 370 380 390
LGHPLGASGC RILVTLLHTL ERMGRSRGVA ALCIGGGMGI AMCVQRE
Length:397
Mass (Da):41,351
Last modified:September 13, 2004 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iE3A8DAFB6F341B18
GO
Isoform 2 (identifier: Q9BWD1-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-19: MNAGSDPVVIVSAARTIIG → MGSHPVLRIWGNRRATAASLGRSGGRLSSPRLLRVVAPTLTFAQTSRC

Note: No experimental confirmation available.
Show »
Length:426
Mass (Da):44,643
Checksum:i5C4390424BB96169
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti169K → T in AAB30856 (PubMed:7911016).Curated1
Sequence conflicti262V → A in AAB30856 (PubMed:7911016).Curated1
Sequence conflicti375R → G in AAM00223 (Ref. 2) Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_019686211K → R1 PublicationCorresponds to variant dbSNP:rs25683Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0562171 – 19MNAGS…RTIIG → MGSHPVLRIWGNRRATAASL GRSGGRLSSPRLLRVVAPTL TFAQTSRC in isoform 2. 1 PublicationAdd BLAST19

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
S70154 mRNA Translation: AAB30856.1
AF356877 mRNA Translation: AAM00223.1
AK294273 mRNA Translation: BAH11719.1
AL135914 Genomic DNA No translation available.
CH471051 Genomic DNA Translation: EAW47619.1
CH471051 Genomic DNA Translation: EAW47620.1
BC000408 mRNA Translation: AAH00408.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS5268.1 [Q9BWD1-1]

Protein sequence database of the Protein Information Resource

More...
PIRi
JC2378

NCBI Reference Sequences

More...
RefSeqi
NP_001290182.1, NM_001303253.1 [Q9BWD1-2]
NP_005882.2, NM_005891.2 [Q9BWD1-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000367048; ENSP00000356015; ENSG00000120437 [Q9BWD1-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
39

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:39

UCSC genome browser

More...
UCSCi
uc010kjy.4 human [Q9BWD1-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
S70154 mRNA Translation: AAB30856.1
AF356877 mRNA Translation: AAM00223.1
AK294273 mRNA Translation: BAH11719.1
AL135914 Genomic DNA No translation available.
CH471051 Genomic DNA Translation: EAW47619.1
CH471051 Genomic DNA Translation: EAW47620.1
BC000408 mRNA Translation: AAH00408.1
CCDSiCCDS5268.1 [Q9BWD1-1]
PIRiJC2378
RefSeqiNP_001290182.1, NM_001303253.1 [Q9BWD1-2]
NP_005882.2, NM_005891.2 [Q9BWD1-1]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1WL4X-ray1.55A1-397[»]
1WL5X-ray2.26A1-397[»]
SMRiQ9BWD1
ModBaseiSearch...

Protein-protein interaction databases

BioGridi106557, 41 interactors
IntActiQ9BWD1, 7 interactors
STRINGi9606.ENSP00000356015

Chemistry databases

DrugBankiDB01992 Coenzyme A
DB01915 S-Hydroxycysteine
GuidetoPHARMACOLOGYi2436
SwissLipidsiSLP:000001266

PTM databases

iPTMnetiQ9BWD1
PhosphoSitePlusiQ9BWD1
SwissPalmiQ9BWD1

Polymorphism and mutation databases

BioMutaiACAT2
DMDMi52000838

2D gel databases

OGPiQ9BWD1
REPRODUCTION-2DPAGEiIPI00291419

Proteomic databases

EPDiQ9BWD1
jPOSTiQ9BWD1
MassIVEiQ9BWD1
MaxQBiQ9BWD1
PaxDbiQ9BWD1
PeptideAtlasiQ9BWD1
PRIDEiQ9BWD1
ProteomicsDBi6403
79268 [Q9BWD1-1]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
39
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000367048; ENSP00000356015; ENSG00000120437 [Q9BWD1-1]
GeneIDi39
KEGGihsa:39
UCSCiuc010kjy.4 human [Q9BWD1-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
39
DisGeNETi39

GeneCards: human genes, protein and diseases

More...
GeneCardsi
ACAT2
HGNCiHGNC:94 ACAT2
HPAiCAB021106
HPA025736
HPA025765
HPA025811
MalaCardsiACAT2
MIMi100678 gene+phenotype
neXtProtiNX_Q9BWD1
OpenTargetsiENSG00000120437
PharmGKBiPA19

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG1391 Eukaryota
COG0183 LUCA
GeneTreeiENSGT00950000182771
HOGENOMiHOG000012238
InParanoidiQ9BWD1
KOiK00626
OMAiAWSCQMV
OrthoDBi1129049at2759
PhylomeDBiQ9BWD1
TreeFamiTF300650

Enzyme and pathway databases

UniPathwayiUPA00199
BioCyciMetaCyc:ENSG00000120437-MONOMER
BRENDAi2.3.1.9 2681
ReactomeiR-HSA-191273 Cholesterol biosynthesis

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
ACAT2 human
EvolutionaryTraceiQ9BWD1

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
ACAT2

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
39

Pharos

More...
Pharosi
Q9BWD1

Protein Ontology

More...
PROi
PR:Q9BWD1

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000120437 Expressed in 225 organ(s), highest expression level in testis
GenevisibleiQ9BWD1 HS

Family and domain databases

CDDicd00751 thiolase, 1 hit
Gene3Di3.40.47.10, 2 hits
InterProiView protein in InterPro
IPR002155 Thiolase
IPR016039 Thiolase-like
IPR020610 Thiolase_AS
IPR020617 Thiolase_C
IPR020613 Thiolase_CS
IPR020616 Thiolase_N
PfamiView protein in Pfam
PF02803 Thiolase_C, 1 hit
PF00108 Thiolase_N, 1 hit
PIRSFiPIRSF000429 Ac-CoA_Ac_transf, 1 hit
SUPFAMiSSF53901 SSF53901, 2 hits
TIGRFAMsiTIGR01930 AcCoA-C-Actrans, 1 hit
PROSITEiView protein in PROSITE
PS00737 THIOLASE_2, 1 hit
PS00099 THIOLASE_3, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiTHIC_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9BWD1
Secondary accession number(s): B7Z233
, E1P5B1, Q16146, Q5TCL7, Q8TDM4
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: September 13, 2004
Last sequence update: September 13, 2004
Last modified: September 18, 2019
This is version 173 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. SIMILARITY comments
    Index of protein domains and families
  3. Human chromosome 6
    Human chromosome 6: entries, gene names and cross-references to MIM
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  6. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  7. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again