Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Acetyl-CoA acetyltransferase, cytosolic

Gene

ACAT2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Catalytic activityi

2 acetyl-CoA = CoA + acetoacetyl-CoA.PROSITE-ProRule annotation

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Active sitei92Acyl-thioester intermediate1
Active sitei353Proton acceptor1
Active sitei383Proton acceptor1

GO - Molecular functioni

  • 3-hydroxyacyl-CoA dehydrogenase activity Source: GO_Central
  • acetyl-CoA C-acetyltransferase activity Source: BHF-UCL
  • acetyl-CoA C-acyltransferase activity Source: GO_Central
  • enoyl-CoA hydratase activity Source: GO_Central

GO - Biological processi

Keywordsi

Molecular functionAcyltransferase, Transferase

Enzyme and pathway databases

BioCyciMetaCyc:ENSG00000120437-MONOMER
BRENDAi2.3.1.9 2681
ReactomeiR-HSA-191273 Cholesterol biosynthesis

Chemistry databases

SwissLipidsiSLP:000001266

Names & Taxonomyi

Protein namesi
Recommended name:
Acetyl-CoA acetyltransferase, cytosolic (EC:2.3.1.9)
Alternative name(s):
Acetyl-CoA transferase-like protein
Cytosolic acetoacetyl-CoA thiolase
Gene namesi
Name:ACAT2
Synonyms:ACTL
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 6

Organism-specific databases

EuPathDBiHostDB:ENSG00000120437.8
HGNCiHGNC:94 ACAT2
MIMi100678 gene+phenotype
neXtProtiNX_Q9BWD1

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm

Pathology & Biotechi

Organism-specific databases

DisGeNETi39
MalaCardsiACAT2
MIMi100678 gene+phenotype
OpenTargetsiENSG00000120437
PharmGKBiPA19

Chemistry databases

DrugBankiDB01992 Coenzyme A
DB01915 S-Hydroxycysteine

Polymorphism and mutation databases

BioMutaiACAT2
DMDMi52000838

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002064091 – 397Acetyl-CoA acetyltransferase, cytosolicAdd BLAST397

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei1N-acetylmethionineCombined sources1
Modified residuei200N6-acetyllysineCombined sources1
Modified residuei233N6-acetyllysineCombined sources1
Modified residuei235N6-acetyllysineCombined sources1

Keywords - PTMi

Acetylation

Proteomic databases

EPDiQ9BWD1
MaxQBiQ9BWD1
PaxDbiQ9BWD1
PeptideAtlasiQ9BWD1
PRIDEiQ9BWD1
ProteomicsDBi79268

2D gel databases

OGPiQ9BWD1
REPRODUCTION-2DPAGEiIPI00291419

PTM databases

iPTMnetiQ9BWD1
PhosphoSitePlusiQ9BWD1
SwissPalmiQ9BWD1

Expressioni

Gene expression databases

BgeeiENSG00000120437 Expressed in 225 organ(s), highest expression level in testis
CleanExiHS_ACAT2
GenevisibleiQ9BWD1 HS

Organism-specific databases

HPAiCAB021106
HPA025736
HPA025765
HPA025811

Interactioni

Subunit structurei

Homotetramer.

Binary interactionsi

Protein-protein interaction databases

BioGridi106557, 40 interactors
IntActiQ9BWD1, 5 interactors
STRINGi9606.ENSP00000356015

Structurei

Secondary structure

1397
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

ProteinModelPortaliQ9BWD1
SMRiQ9BWD1
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ9BWD1

Family & Domainsi

Sequence similaritiesi

Belongs to the thiolase family.Curated

Phylogenomic databases

eggNOGiKOG1391 Eukaryota
COG0183 LUCA
GeneTreeiENSGT00390000009412
HOGENOMiHOG000012238
HOVERGENiHBG003112
InParanoidiQ9BWD1
KOiK00626
OMAiAWSCQMV
OrthoDBiEOG091G09C6
PhylomeDBiQ9BWD1
TreeFamiTF300650

Family and domain databases

CDDicd00751 thiolase, 1 hit
Gene3Di3.40.47.10, 2 hits
InterProiView protein in InterPro
IPR002155 Thiolase
IPR016039 Thiolase-like
IPR020610 Thiolase_AS
IPR020617 Thiolase_C
IPR020613 Thiolase_CS
IPR020616 Thiolase_N
PfamiView protein in Pfam
PF02803 Thiolase_C, 1 hit
PF00108 Thiolase_N, 1 hit
PIRSFiPIRSF000429 Ac-CoA_Ac_transf, 1 hit
SUPFAMiSSF53901 SSF53901, 2 hits
TIGRFAMsiTIGR01930 AcCoA-C-Actrans, 1 hit
PROSITEiView protein in PROSITE
PS00737 THIOLASE_2, 1 hit
PS00099 THIOLASE_3, 1 hit

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: Q9BWD1-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MNAGSDPVVI VSAARTIIGS FNGALAAVPV QDLGSTVIKE VLKRATVAPE
60 70 80 90 100
DVSEVIFGHV LAAGCGQNPV RQASVGAGIP YSVPAWSCQM ICGSGLKAVC
110 120 130 140 150
LAVQSIGIGD SSIVVAGGME NMSKAPHLAY LRTGVKIGEM PLTDSILCDG
160 170 180 190 200
LTDAFHNCHM GITAENVAKK WQVSREDQDK VAVLSQNRTE NAQKAGHFDK
210 220 230 240 250
EIVPVLVSTR KGLIEVKTDE FPRHGSNIEA MSKLKPYFLT DGTGTVTPAN
260 270 280 290 300
ASGINDGAAA VVLMKKSEAD KRGLTPLARI VSWSQVGVEP SIMGIGPIPA
310 320 330 340 350
IKQAVTKAGW SLEDVDIFEI NEAFAAVSAA IVKELGLNPE KVNIEGGAIA
360 370 380 390
LGHPLGASGC RILVTLLHTL ERMGRSRGVA ALCIGGGMGI AMCVQRE
Length:397
Mass (Da):41,351
Last modified:September 13, 2004 - v2
Checksum:iE3A8DAFB6F341B18
GO
Isoform 2 (identifier: Q9BWD1-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-19: MNAGSDPVVIVSAARTIIG → MGSHPVLRIWGNRRATAASLGRSGGRLSSPRLLRVVAPTLTFAQTSRC

Note: No experimental confirmation available.
Show »
Length:426
Mass (Da):44,643
Checksum:i5C4390424BB96169
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti169K → T in AAB30856 (PubMed:7911016).Curated1
Sequence conflicti262V → A in AAB30856 (PubMed:7911016).Curated1
Sequence conflicti375R → G in AAM00223 (Ref. 2) Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_019686211K → R1 PublicationCorresponds to variant dbSNP:rs25683Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0562171 – 19MNAGS…RTIIG → MGSHPVLRIWGNRRATAASL GRSGGRLSSPRLLRVVAPTL TFAQTSRC in isoform 2. 1 PublicationAdd BLAST19

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
S70154 mRNA Translation: AAB30856.1
AF356877 mRNA Translation: AAM00223.1
AK294273 mRNA Translation: BAH11719.1
AL135914 Genomic DNA No translation available.
CH471051 Genomic DNA Translation: EAW47619.1
CH471051 Genomic DNA Translation: EAW47620.1
BC000408 mRNA Translation: AAH00408.1
CCDSiCCDS5268.1 [Q9BWD1-1]
PIRiJC2378
RefSeqiNP_001290182.1, NM_001303253.1 [Q9BWD1-2]
NP_005882.2, NM_005891.2 [Q9BWD1-1]
UniGeneiHs.571037

Genome annotation databases

EnsembliENST00000367048; ENSP00000356015; ENSG00000120437 [Q9BWD1-1]
GeneIDi39
KEGGihsa:39
UCSCiuc010kjy.4 human [Q9BWD1-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
S70154 mRNA Translation: AAB30856.1
AF356877 mRNA Translation: AAM00223.1
AK294273 mRNA Translation: BAH11719.1
AL135914 Genomic DNA No translation available.
CH471051 Genomic DNA Translation: EAW47619.1
CH471051 Genomic DNA Translation: EAW47620.1
BC000408 mRNA Translation: AAH00408.1
CCDSiCCDS5268.1 [Q9BWD1-1]
PIRiJC2378
RefSeqiNP_001290182.1, NM_001303253.1 [Q9BWD1-2]
NP_005882.2, NM_005891.2 [Q9BWD1-1]
UniGeneiHs.571037

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1WL4X-ray1.55A1-397[»]
1WL5X-ray2.26A1-397[»]
ProteinModelPortaliQ9BWD1
SMRiQ9BWD1
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi106557, 40 interactors
IntActiQ9BWD1, 5 interactors
STRINGi9606.ENSP00000356015

Chemistry databases

DrugBankiDB01992 Coenzyme A
DB01915 S-Hydroxycysteine
SwissLipidsiSLP:000001266

PTM databases

iPTMnetiQ9BWD1
PhosphoSitePlusiQ9BWD1
SwissPalmiQ9BWD1

Polymorphism and mutation databases

BioMutaiACAT2
DMDMi52000838

2D gel databases

OGPiQ9BWD1
REPRODUCTION-2DPAGEiIPI00291419

Proteomic databases

EPDiQ9BWD1
MaxQBiQ9BWD1
PaxDbiQ9BWD1
PeptideAtlasiQ9BWD1
PRIDEiQ9BWD1
ProteomicsDBi79268

Protocols and materials databases

DNASUi39
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000367048; ENSP00000356015; ENSG00000120437 [Q9BWD1-1]
GeneIDi39
KEGGihsa:39
UCSCiuc010kjy.4 human [Q9BWD1-1]

Organism-specific databases

CTDi39
DisGeNETi39
EuPathDBiHostDB:ENSG00000120437.8
GeneCardsiACAT2
HGNCiHGNC:94 ACAT2
HPAiCAB021106
HPA025736
HPA025765
HPA025811
MalaCardsiACAT2
MIMi100678 gene+phenotype
neXtProtiNX_Q9BWD1
OpenTargetsiENSG00000120437
PharmGKBiPA19
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG1391 Eukaryota
COG0183 LUCA
GeneTreeiENSGT00390000009412
HOGENOMiHOG000012238
HOVERGENiHBG003112
InParanoidiQ9BWD1
KOiK00626
OMAiAWSCQMV
OrthoDBiEOG091G09C6
PhylomeDBiQ9BWD1
TreeFamiTF300650

Enzyme and pathway databases

BioCyciMetaCyc:ENSG00000120437-MONOMER
BRENDAi2.3.1.9 2681
ReactomeiR-HSA-191273 Cholesterol biosynthesis

Miscellaneous databases

ChiTaRSiACAT2 human
EvolutionaryTraceiQ9BWD1
GeneWikiiACAT2
GenomeRNAii39
PROiPR:Q9BWD1
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000120437 Expressed in 225 organ(s), highest expression level in testis
CleanExiHS_ACAT2
GenevisibleiQ9BWD1 HS

Family and domain databases

CDDicd00751 thiolase, 1 hit
Gene3Di3.40.47.10, 2 hits
InterProiView protein in InterPro
IPR002155 Thiolase
IPR016039 Thiolase-like
IPR020610 Thiolase_AS
IPR020617 Thiolase_C
IPR020613 Thiolase_CS
IPR020616 Thiolase_N
PfamiView protein in Pfam
PF02803 Thiolase_C, 1 hit
PF00108 Thiolase_N, 1 hit
PIRSFiPIRSF000429 Ac-CoA_Ac_transf, 1 hit
SUPFAMiSSF53901 SSF53901, 2 hits
TIGRFAMsiTIGR01930 AcCoA-C-Actrans, 1 hit
PROSITEiView protein in PROSITE
PS00737 THIOLASE_2, 1 hit
PS00099 THIOLASE_3, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiTHIC_HUMAN
AccessioniPrimary (citable) accession number: Q9BWD1
Secondary accession number(s): B7Z233
, E1P5B1, Q16146, Q5TCL7, Q8TDM4
Entry historyiIntegrated into UniProtKB/Swiss-Prot: September 13, 2004
Last sequence update: September 13, 2004
Last modified: November 7, 2018
This is version 164 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. Human chromosome 6
    Human chromosome 6: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again