Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Nuclear pore complex protein Nup85

Gene

NUP85

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Essential component of the nuclear pore complex (NPC) that seems to be required for NPC assembly and maintenance (PubMed:12718872). As part of the NPC Nup107-160 subcomplex plays a role in RNA export and in tethering NUP96/Nup98 and NUP153 to the nucleus (PubMed:12718872). The Nup107-160 complex seems to be required for spindle assembly during mitosis (PubMed:16807356). NUP85 is required for membrane clustering of CCL2-activated CCR2 (PubMed:15995708). Seems to be involved in CCR2-mediated chemotaxis of monocytes and may link activated CCR2 to the phosphatidyl-inositol 3-kinase-Rac-lammellipodium protrusion cascade (PubMed:15995708).3 Publications

GO - Molecular functioni

GO - Biological processi

Keywordsi

Biological processmRNA transport, Protein transport, Translocation, Transport

Enzyme and pathway databases

ReactomeiR-HSA-1169408 ISG15 antiviral mechanism
R-HSA-141444 Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal
R-HSA-159227 Transport of the SLBP independent Mature mRNA
R-HSA-159230 Transport of the SLBP Dependant Mature mRNA
R-HSA-159231 Transport of Mature mRNA Derived from an Intronless Transcript
R-HSA-159236 Transport of Mature mRNA derived from an Intron-Containing Transcript
R-HSA-165054 Rev-mediated nuclear export of HIV RNA
R-HSA-168271 Transport of Ribonucleoproteins into the Host Nucleus
R-HSA-168276 NS1 Mediated Effects on Host Pathways
R-HSA-168325 Viral Messenger RNA Synthesis
R-HSA-168333 NEP/NS2 Interacts with the Cellular Export Machinery
R-HSA-170822 Regulation of Glucokinase by Glucokinase Regulatory Protein
R-HSA-180746 Nuclear import of Rev protein
R-HSA-180910 Vpr-mediated nuclear import of PICs
R-HSA-191859 snRNP Assembly
R-HSA-2467813 Separation of Sister Chromatids
R-HSA-2500257 Resolution of Sister Chromatid Cohesion
R-HSA-3108214 SUMOylation of DNA damage response and repair proteins
R-HSA-3301854 Nuclear Pore Complex (NPC) Disassembly
R-HSA-3371453 Regulation of HSF1-mediated heat shock response
R-HSA-4551638 SUMOylation of chromatin organization proteins
R-HSA-4570464 SUMOylation of RNA binding proteins
R-HSA-4615885 SUMOylation of DNA replication proteins
R-HSA-5578749 Transcriptional regulation by small RNAs
R-HSA-5663220 RHO GTPases Activate Formins
R-HSA-6784531 tRNA processing in the nucleus
R-HSA-68877 Mitotic Prometaphase

Protein family/group databases

TCDBi1.I.1.1.3 the eukaryotic nuclear pore complex (e-npc) family

Names & Taxonomyi

Protein namesi
Recommended name:
Nuclear pore complex protein Nup85
Alternative name(s):
85 kDa nucleoporin
FROUNT
Nucleoporin Nup75
Nucleoporin Nup85
Pericentrin-1
Gene namesi
Name:NUP85
Synonyms:NUP75, PCNT1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 17

Organism-specific databases

EuPathDBiHostDB:ENSG00000125450.10
HGNCiHGNC:8734 NUP85
MIMi170285 gene
neXtProtiNX_Q9BW27

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Centromere, Chromosome, Cytoplasm, Cytoskeleton, Kinetochore, Membrane, Nuclear pore complex, Nucleus

Pathology & Biotechi

Organism-specific databases

DisGeNETi79902
OpenTargetsiENSG00000125450
PharmGKBiPA142671241

Polymorphism and mutation databases

BioMutaiNUP85
DMDMi74733394

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00003241871 – 656Nuclear pore complex protein Nup85Add BLAST656

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei1N-acetylmethionineCombined sources1
Modified residuei92N6-acetyllysineBy similarity1
Modified residuei223PhosphoserineCombined sources1

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

EPDiQ9BW27
MaxQBiQ9BW27
PaxDbiQ9BW27
PeptideAtlasiQ9BW27
PRIDEiQ9BW27
ProteomicsDBi79251

PTM databases

iPTMnetiQ9BW27
PhosphoSitePlusiQ9BW27

Expressioni

Gene expression databases

BgeeiENSG00000125450
CleanExiHS_NUP85
ExpressionAtlasiQ9BW27 baseline and differential
GenevisibleiQ9BW27 HS

Organism-specific databases

HPAiHPA061910
HPA062595

Interactioni

Subunit structurei

Component of the nuclear pore complex (NPC) (PubMed:12196509). Component of the NPC Nup107-160 subcomplex, consisting of at least NUP107, NUP98/Nup96, NUP160, NUP133, NUP85, NUP37, NUP43 and SEC13 (PubMed:15146057). Interacts with NUP160, NUP133 and SEC13 (PubMed:12718872). Interacts with NUP37, NUP107 and NUP43 (PubMed:15146057). Interacts with CCR2 (PubMed:15995708).4 Publications

Binary interactionsi

Show more details

Protein-protein interaction databases

BioGridi122985, 59 interactors
CORUMiQ9BW27
IntActiQ9BW27, 27 interactors
MINTiQ9BW27
STRINGi9606.ENSP00000245544

Structurei

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
5A9Qelectron microscopy23.008/H/Q/Z1-656[»]
ProteinModelPortaliQ9BW27
SMRiQ9BW27
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the nucleoporin Nup85 family.Curated

Phylogenomic databases

eggNOGiKOG2271 Eukaryota
ENOG410YK7T LUCA
GeneTreeiENSGT00390000000204
HOGENOMiHOG000230494
HOVERGENiHBG059778
InParanoidiQ9BW27
KOiK14304
OMAiSICKIMA
OrthoDBiEOG091G05IH
PhylomeDBiQ9BW27
TreeFamiTF323240

Family and domain databases

InterProiView protein in InterPro
IPR011502 Nucleoporin_Nup85
PANTHERiPTHR13373 PTHR13373, 1 hit
PfamiView protein in Pfam
PF07575 Nucleopor_Nup85, 1 hit

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9BW27-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MEELDGEPTV TLIPGVNSKK NQMYFDWGPG EMLVCETSFN KKEKSEMVPS
60 70 80 90 100
CPFIYIIRKD VDVYSQILRK LFNESHGIFL GLQRIDEELT GKSRKSQLVR
110 120 130 140 150
VSKNYRSVIR ACMEEMHQVA IAAKDPANGR QFSSQVSILS AMELIWNLCE
160 170 180 190 200
ILFIEVAPAG PLLLHLLDWV RLHVCEVDSL SADVLGSENP SKHDSFWNLV
210 220 230 240 250
TILVLQGRLD EARQMLSKEA DASPASAGIC RIMGDLMRTM PILSPGNTQT
260 270 280 290 300
LTELELKWQH WHEECERYLQ DSTFATSPHL ESLLKIMLGD EAALLEQKEL
310 320 330 340 350
LSNWYHFLVT RLLYSNPTVK PIDLHYYAQS SLDLFLGGES SPEPLDNILL
360 370 380 390 400
AAFEFDIHQV IKECSIALSN WWFVAHLTDL LDHCKLLQSH NLYFGSNMRE
410 420 430 440 450
FLLLEYASGL FAHPSLWQLG VDYFDYCPEL GRVSLELHIE RIPLNTEQKA
460 470 480 490 500
LKVLRICEQR QMTEQVRSIC KILAMKAVRN NRLGSALSWS IRAKDAAFAT
510 520 530 540 550
LVSDRFLRDY CERGCFSDLD LIDNLGPAMM LSDRLTFLGK YREFHRMYGE
560 570 580 590 600
KRFADAASLL LSLMTSRIAP RSFWMTLLTD ALPLLEQKQV IFSAEQTYEL
610 620 630 640 650
MRCLEDLTSR RPVHGESDTE QLQDDDIETT KVEMLRLSLA RNLARAIIRE

GSLEGS
Length:656
Mass (Da):75,019
Last modified:June 1, 2001 - v1
Checksum:i1AE2BA17D9CADF3D
GO
Isoform 2 (identifier: Q9BW27-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-31: MEELDGEPTVTLIPGVNSKKNQMYFDWGPGE → MAASSAARSPFCQQWSSSGTCVRFFLLKWPQ
     32-199: Missing.
     591-656: IFSAEQTYEL...IIREGSLEGS → KVAAAVVFFA...VVLPVRVYSP

Note: No experimental confirmation available.
Show »
Length:462
Mass (Da):52,599
Checksum:i43974BA2EDF165DF
GO
Isoform 3 (identifier: Q9BW27-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-46: Missing.

Note: No experimental confirmation available.
Show »
Length:610
Mass (Da):69,800
Checksum:i9DAEB179E3BD6FD4
GO

Sequence cautioni

The sequence CAD38749 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti501L → P in BAB14130 (PubMed:14702039).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0560791 – 46Missing in isoform 3. CuratedAdd BLAST46
Alternative sequenceiVSP_0560801 – 31MEELD…WGPGE → MAASSAARSPFCQQWSSSGT CVRFFLLKWPQ in isoform 2. 1 PublicationAdd BLAST31
Alternative sequenceiVSP_05608132 – 199Missing in isoform 2. 1 PublicationAdd BLAST168
Alternative sequenceiVSP_056082591 – 656IFSAE…SLEGS → KVAAAVVFFACQSLLELSCI AVADVRVSSFVVLPVRVYSP in isoform 2. 1 PublicationAdd BLAST66

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF514995 mRNA Translation: AAM76706.1
AF498261 mRNA Translation: AAM18528.1
AK022611 mRNA Translation: BAB14130.1
AK297574 mRNA Translation: BAG59965.1
AK298519 mRNA Translation: BAG60723.1
AL833893 mRNA Translation: CAD38749.1 Different initiation.
AC022211 Genomic DNA No translation available.
CH471099 Genomic DNA Translation: EAW89251.1
BC000697 mRNA Translation: AAH00697.1
CCDSiCCDS32730.1 [Q9BW27-1]
RefSeqiNP_001290205.1, NM_001303276.1 [Q9BW27-3]
NP_079120.1, NM_024844.4 [Q9BW27-1]
UniGeneiHs.362817

Genome annotation databases

EnsembliENST00000245544; ENSP00000245544; ENSG00000125450 [Q9BW27-1]
GeneIDi79902
KEGGihsa:79902
UCSCiuc002jng.2 human [Q9BW27-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiNUP85_HUMAN
AccessioniPrimary (citable) accession number: Q9BW27
Secondary accession number(s): B4DMQ3
, B4DPW1, Q8NDI4, Q9H9U1
Entry historyiIntegrated into UniProtKB/Swiss-Prot: March 18, 2008
Last sequence update: June 1, 2001
Last modified: June 20, 2018
This is version 140 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 17
    Human chromosome 17: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  4. SIMILARITY comments
    Index of protein domains and families

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health