Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Due to a server migration, the UniProt 'ID mapping', 'Peptide search' and 'community bibliography submission' tools will not be available on the 19th April 2021 during the morning (EST).

UniProtKB - Q9BW11 (MAD3_HUMAN)

Entry version 152 (07 Apr 2021)
Sequence version 1 (01 Jun 2001)
Previous versions | rss
Add a publicationFeedback
Protein

Max dimerization protein 3

Gene

MXD3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Transcriptional repressor. Binds with MAX to form a sequence-specific DNA-binding protein complex which recognizes the core sequence 5'-CAC[GA]TG-3'. Antagonizes MYC transcriptional activity by competing for MAX and suppresses MYC dependent cell transformation (By similarity).By similarity

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionDNA-binding, Repressor
Biological processTranscription, Transcription regulation

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		Q9BW11

SIGNOR Signaling Network Open Resource

More...SIGNORi		Q9BW11

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Max dimerization protein 3
Short name:
Max dimerizer 3
Alternative name(s):
Class C basic helix-loop-helix protein 13
Short name:
bHLHc13
Max-associated protein 3
Max-interacting transcriptional repressor MAD3
Myx
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:MXD3
Synonyms:BHLHC13, MAD3
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 5

Organism-specific databases

Human Gene Nomenclature Database

More...HGNCi		HGNC:14008, MXD3

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		609450, gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_Q9BW11

Eukaryotic Pathogen, Vector and Host Database Resources

More...VEuPathDBi		HostDB:ENSG00000213347.10

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Keywords - Cellular componenti

Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...DisGeNETi		83463

Open Targets

More...OpenTargetsi		ENSG00000213347

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA134892226

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		Q9BW11, Tbio

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		MXD3

Domain mapping of disease mutations (DMDM)

More...DMDMi		74733390

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002537071 – 206Max dimerization protein 3Add BLAST206

Proteomic databases

Encyclopedia of Proteome Dynamics

More...EPDi		Q9BW11

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		Q9BW11

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		Q9BW11

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q9BW11

PeptideAtlas

More...PeptideAtlasi		Q9BW11

PRoteomics IDEntifications database

More...PRIDEi		Q9BW11

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		5676
79247 [Q9BW11-1]
79248 [Q9BW11-2]
79249 [Q9BW11-3]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q9BW11

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q9BW11

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000213347, Expressed in blood and 187 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		Q9BW11, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q9BW11, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000213347, Tissue enhanced (bone marrow, lymphoid tissue)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Efficient DNA binding requires dimerization with another bHLH protein. Binds DNA as a heterodimer with MAX.

Interacts with SIN3A AND SIN3B.

Interacts with RNF17 (By similarity).

By similarity

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

GO - Molecular functioni

Complete GO annotation on QuickGO ...

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		123658, 36 interactors

Protein interaction database and analysis system

More...IntActi		Q9BW11, 31 interactors

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000401867

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		Q9BW11, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		Q9BW11

Database of comparative protein structure models

More...ModBasei		Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini57 – 109bHLHPROSITE-ProRule annotationAdd BLAST53

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni8 – 25Interaction with SIN3A and SIN3BBy similarityAdd BLAST18

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG2483, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00940000161050

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_882682_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q9BW11

Identification of Orthologs from Complete Genome Data

More...OMAi		LYSCQAH

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q9BW11

TreeFam database of animal gene trees

More...TreeFami		TF315654

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...Gene3Di		4.10.280.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR011598, bHLH_dom
IPR036638, HLH_DNA-bd_sf

Pfam protein domain database

More...Pfami		View protein in Pfam
PF00010, HLH, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00353, HLH, 1 hit

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF47459, SSF47459, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS50888, BHLH, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9BW11-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MEPLASNIQV LLQAAEFLER REREAEHGYA SLCPHRSPGP IHRRKKRPPQ 
        60         70         80         90        100
APGAQDSGRS VHNELEKRRR AQLKRCLERL KQQMPLGADC ARYTTLSLLR 
       110        120        130        140        150
RARMHIQKLE DQEQRARQLK ERLRSKQQSL QRQLEQLRGL AGAAERERLR 
       160        170        180        190        200
ADSLDSSGLS SERSDSDQEE LEVDVESLVF GGEAELLRGF VAGQEHSYSH 

GGGAWL
Length:206
Mass (Da):23,477
Last modified:June 1, 2001 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i2C49E02C10F9FC2E
GO
Isoform 2 (identifier: Q9BW11-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     60-68: Missing.

Show »
Length:197
Mass (Da):22,384
Checksum:i25B97E27D10D5CC2
GO
Isoform 3 (identifier: Q9BW11-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     169-206: EELEVDVESLVFGGEAELLRGFVAGQEHSYSHGGGAWL → VLPNENGGTPNHRPTGRGNNISSHH

Show »
Length:193
Mass (Da):22,065
Checksum:iFBA651F2D547B225
GO
Isoform 4 (identifier: Q9BW11-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     169-206: EELEVDVESL...SYSHGGGAWL → GECPEAEGLC...GRGNNISSHH

Show »
Length:388
Mass (Da):42,821
Checksum:iB340733F42A5F00E
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
D6RED4D6RED4_HUMAN
Max dimerization protein 3
MXD3
124Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D6RD21D6RD21_HUMAN
Max dimerization protein 3
MXD3
74Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti88A → G in AAP97233 (Ref. 1) Curated1
Sequence conflicti129S → G in BAD96299 (Ref. 3) Curated1
Sequence conflicti134 – 135LE → WM in AAP97233 (Ref. 1) Curated2
Sequence conflicti155D → N in AAP97233 (Ref. 1) Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_049546114Q → H. Corresponds to variant dbSNP:rs35691394Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_02110960 – 68Missing in isoform 2. 1 Publication9
Alternative sequenceiVSP_021110169 – 206EELEV…GGAWL → VLPNENGGTPNHRPTGRGNN ISSHH in isoform 3. 1 PublicationAdd BLAST38
Alternative sequenceiVSP_057220169 – 206EELEV…GGAWL → GECPEAEGLCGPRGEPGLLT GPLPAQRSWRWMWRAWCLGV RPSCCGASSPARSTATRTAA APGYDVPHPGRASALYSCQA HLPGRSPPQAFRAARSHLLE WTKRTLVWEQVLPKHPAAGC QAGPLEGKGQDSSGPPWTPA GQAAWARAQAFGSAAPKGTG SLLGLFPSWTRPPAFASHKL YSIFIKSLFHNFPSIVLPNE NGGTPNHRPTGRGNNISSHH in isoform 4. 1 PublicationAdd BLAST38

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AF114834 mRNA Translation: AAP97233.1
AK057034 mRNA Translation: BAB71352.1
AK303397 mRNA Translation: BAG64453.1
AK316468 mRNA Translation: BAH14839.1
AK222579 mRNA Translation: BAD96299.1
AL833959 mRNA Translation: CAD38809.2
AC146507 Genomic DNA No translation available.
BC000745 mRNA Translation: AAH00745.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS4416.1 [Q9BW11-1]
CCDS47347.1 [Q9BW11-3]

NCBI Reference Sequences

More...RefSeqi		NP_001136407.1, NM_001142935.1 [Q9BW11-3]
NP_112590.1, NM_031300.3 [Q9BW11-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000423571; ENSP00000389716; ENSG00000213347 [Q9BW11-4]
ENST00000427908; ENSP00000416921; ENSG00000213347 [Q9BW11-3]
ENST00000439742; ENSP00000401867; ENSG00000213347 [Q9BW11-1]
ENST00000513063; ENSP00000421463; ENSG00000213347 [Q9BW11-1]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		83463

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:83463

UCSC genome browser

More...UCSCi		uc003mga.4, human [Q9BW11-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF114834 mRNA Translation: AAP97233.1
AK057034 mRNA Translation: BAB71352.1
AK303397 mRNA Translation: BAG64453.1
AK316468 mRNA Translation: BAH14839.1
AK222579 mRNA Translation: BAD96299.1
AL833959 mRNA Translation: CAD38809.2
AC146507 Genomic DNA No translation available.
BC000745 mRNA Translation: AAH00745.1
CCDSiCCDS4416.1 [Q9BW11-1]
CCDS47347.1 [Q9BW11-3]
RefSeqiNP_001136407.1, NM_001142935.1 [Q9BW11-3]
NP_112590.1, NM_031300.3 [Q9BW11-1]

3D structure databases

SMRiQ9BW11
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi123658, 36 interactors
IntActiQ9BW11, 31 interactors
STRINGi9606.ENSP00000401867

PTM databases

iPTMnetiQ9BW11
PhosphoSitePlusiQ9BW11

Genetic variation databases

BioMutaiMXD3
DMDMi74733390

Proteomic databases

EPDiQ9BW11
jPOSTiQ9BW11
MassIVEiQ9BW11
PaxDbiQ9BW11
PeptideAtlasiQ9BW11
PRIDEiQ9BW11
ProteomicsDBi5676
79247 [Q9BW11-1]
79248 [Q9BW11-2]
79249 [Q9BW11-3]

Protocols and materials databases

ABCD curated depository of sequenced antibodies

More...ABCDi		Q9BW11, 1 sequenced antibody

Antibodypedia a portal for validated antibodies

More...Antibodypediai		17372, 231 antibodies

The DNASU plasmid repository

More...DNASUi		83463

Genome annotation databases

EnsembliENST00000423571; ENSP00000389716; ENSG00000213347 [Q9BW11-4]
ENST00000427908; ENSP00000416921; ENSG00000213347 [Q9BW11-3]
ENST00000439742; ENSP00000401867; ENSG00000213347 [Q9BW11-1]
ENST00000513063; ENSP00000421463; ENSG00000213347 [Q9BW11-1]
GeneIDi83463
KEGGihsa:83463
UCSCiuc003mga.4, human [Q9BW11-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		83463
DisGeNETi83463

GeneCards: human genes, protein and diseases

More...GeneCardsi		MXD3
HGNCiHGNC:14008, MXD3
HPAiENSG00000213347, Tissue enhanced (bone marrow, lymphoid tissue)
MIMi609450, gene
neXtProtiNX_Q9BW11
OpenTargetsiENSG00000213347
PharmGKBiPA134892226
VEuPathDBiHostDB:ENSG00000213347.10

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG2483, Eukaryota
GeneTreeiENSGT00940000161050
HOGENOMiCLU_882682_0_0_1
InParanoidiQ9BW11
OMAiLYSCQAH
PhylomeDBiQ9BW11
TreeFamiTF315654

Enzyme and pathway databases

PathwayCommonsiQ9BW11
SIGNORiQ9BW11

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		83463, 6 hits in 1013 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		MXD3, human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		83463
PharosiQ9BW11, Tbio

Protein Ontology

More...PROi		PR:Q9BW11
RNActiQ9BW11, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000213347, Expressed in blood and 187 other tissues
ExpressionAtlasiQ9BW11, baseline and differential
GenevisibleiQ9BW11, HS

Family and domain databases

Gene3Di4.10.280.10, 1 hit
InterProiView protein in InterPro
IPR011598, bHLH_dom
IPR036638, HLH_DNA-bd_sf
PfamiView protein in Pfam
PF00010, HLH, 1 hit
SMARTiView protein in SMART
SM00353, HLH, 1 hit
SUPFAMiSSF47459, SSF47459, 1 hit
PROSITEiView protein in PROSITE
PS50888, BHLH, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiMAD3_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9BW11
Secondary accession number(s): B4E0J1
, Q53HK1, Q7Z4Y0, Q8NDJ7, Q96ME3
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 17, 2006
Last sequence update: June 1, 2001
Last modified: April 7, 2021
This is version 152 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Human chromosome 5
    Human chromosome 5: entries, gene names and cross-references to MIM
  2. Human entries with genetic variants
    List of human entries with genetic variants
  3. Human variants curated from literature reports
    Index of human variants curated from literature reports
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again