Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

PHD finger protein 20

Gene

PHF20

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Methyllysine-binding protein, component of the MOF histone acetyltransferase protein complex. Not required for maintaining the global histone H4 'Lys-16' acetylation (H4K16ac) levels or locus specific histone acetylation, but instead works downstream in transcriptional regulation of MOF target genes (By similarity). As part of the NSL complex it may be involved in acetylation of nucleosomal histone H4 on several lysine residues. Contributes to methyllysine-dependent p53/TP53 stabilization and up-regulation after DNA damage.By similarity2 Publications

Miscellaneous

Antibodies against PHF20 are present in sera from patients with hepatocellular carcinoma, glioblastoma and childhood medulloblastula.

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Function’ section specifies the position and type of each DNA-binding domain present within the protein.<p><a href='/help/dna_bind' target='_top'>More...</a></p>DNA bindingi257 – 269A.T hookAdd BLAST13
<p>This subsection of the ‘Function’ section specifies the position(s) and type(s) of zinc fingers within the protein.<p><a href='/help/zn_fing' target='_top'>More...</a></p>Zinc fingeri452 – 477C2H2-typePROSITE-ProRule annotationAdd BLAST26
Zinc fingeri654 – 700PHD-typeAdd BLAST47

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionChromatin regulator, DNA-binding
Biological processTranscription, Transcription regulation
LigandMetal-binding, Zinc

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-3214847 HATs acetylate histones
R-HSA-6804757 Regulation of TP53 Degradation
R-HSA-6804759 Regulation of TP53 Activity through Association with Co-factors
R-HSA-69541 Stabilization of p53

SIGNOR Signaling Network Open Resource

More...
SIGNORi
Q9BVI0

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
PHD finger protein 20
Alternative name(s):
Glioma-expressed antigen 2
Hepatocellular carcinoma-associated antigen 58
Novel zinc finger protein
Transcription factor TZP
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:PHF20
Synonyms:C20orf104, GLEA2, HCA58, NZF, TZP
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 20

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000025293.15

Human Gene Nomenclature Database

More...
HGNCi
HGNC:16098 PHF20

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
610335 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q9BVI0

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi96C → S: Abolishes homodimerization. 1 Publication1
Mutagenesisi97W → A: Abolishes interaction with methylated p53. 1 Publication1
Mutagenesisi100C → S: Abolishes homodimerization. 1 Publication1
Mutagenesisi103Y → A: Abolishes interaction with methylated p53. 1 Publication1

Organism-specific databases

DisGeNET

More...
DisGeNETi
51230

Open Targets

More...
OpenTargetsi
ENSG00000025293

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA25644

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
PHF20

Domain mapping of disease mutations (DMDM)

More...
DMDMi
32699605

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000593101 – 1012PHD finger protein 20Add BLAST1012

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi96Interchain (with C-100)1 Publication
Disulfide bondi100Interchain (with C-96)1 Publication
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei159PhosphoserineCombined sources1
Modified residuei488PhosphoserineCombined sources1
Modified residuei843N6-acetyllysineCombined sources1
Modified residuei878PhosphoserineCombined sources1
Modified residuei880PhosphoserineCombined sources1

Keywords - PTMi

Acetylation, Disulfide bond, Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q9BVI0

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q9BVI0

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q9BVI0

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9BVI0

PeptideAtlas

More...
PeptideAtlasi
Q9BVI0

PRoteomics IDEntifications database

More...
PRIDEi
Q9BVI0

ProteomicsDB human proteome resource

More...
ProteomicsDBi
79207
79208 [Q9BVI0-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9BVI0

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9BVI0

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in heart, kidney, liver, lung, pancreas, placenta, spleen and testis. Not expressed in brain, skeletal muscle, colon, ovary, prostate, small intestine and thymus. Expressed in colon and ovary cancer cell lines while it is not expressed in the respective normal tissues.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000025293 Expressed in 238 organ(s), highest expression level in endothelial cell

CleanEx database of gene expression profiles

More...
CleanExi
HS_PHF20

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q9BVI0 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9BVI0 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA029619
HPA029620
HPA029621

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Homodimer; disulfide-linked. Component of some MLL1/MLL complex, at least composed of the core components KMT2A/MLL1, ASH2L, HCFC1, WDR5 and RBBP5, as well as the facultative components BAP18, CHD8, E2F6, HSP70, INO80C, KANSL1, LAS1L, MAX, MCRS1, MGA, KAT8/MOF, PELP1, PHF20, PRP31, RING2, RUVB1/TIP49A, RUVB2/TIP49B, SENP3, TAF1, TAF4, TAF6, TAF7, TAF9 and TEX10. Component of the NSL complex at least composed of MOF/KAT8, KANSL1, KANSL2, KANSL3, MCRS1, PHF20, OGT1/OGT, WDR5 and HCFC1.3 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
119393, 19 interactors

ComplexPortal: manually curated resource of macromolecular complexes

More...
ComplexPortali
CPX-809 NSL histone acetyltransferase complex

CORUM comprehensive resource of mammalian protein complexes

More...
CORUMi
Q9BVI0

Protein interaction database and analysis system

More...
IntActi
Q9BVI0, 9 interactors

Molecular INTeraction database

More...
MINTi
Q9BVI0

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000363124

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

11012
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2LDMNMR-A84-147[»]
3P8DX-ray2.00A/B84-147[»]
3Q1JX-ray2.35A4-69[»]
3QIIX-ray2.30A83-150[»]
3SD4X-ray1.93A/B4-69[»]
5TABX-ray1.25A651-698[»]
5TBNNMR-A646-699[»]

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
Q9BVI0

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q9BVI0

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
Q9BVI0

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini4 – 69Tudor 1Add BLAST66
Domaini83 – 147Tudor 2Add BLAST65

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi162 – 221Lys-richAdd BLAST60
Compositional biasi523 – 552Lys-richAdd BLAST30

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The Tudor domain 2 mediates reading of dimethyl-lysine residues.
The Tudor domain 1 doesn't bind dimethyl-lysine residues, due to an atypical and occluded aromatic cage.

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri452 – 477C2H2-typePROSITE-ProRule annotationAdd BLAST26
Zinc fingeri654 – 700PHD-typeAdd BLAST47

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IMXB Eukaryota
ENOG410XX7Z LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000156477

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG053586

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9BVI0

KEGG Orthology (KO)

More...
KOi
K18402

Identification of Orthologs from Complete Genome Data

More...
OMAi
DFSIHRR

Database of Orthologous Groups

More...
OrthoDBi
147824at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9BVI0

TreeFam database of animal gene trees

More...
TreeFami
TF106475

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
3.30.40.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR022255 DUF3776
IPR037915 PHF20
IPR002999 Tudor
IPR019786 Zinc_finger_PHD-type_CS
IPR013087 Znf_C2H2_type
IPR011011 Znf_FYVE_PHD
IPR001965 Znf_PHD
IPR013083 Znf_RING/FYVE/PHD

The PANTHER Classification System

More...
PANTHERi
PTHR15856:SF27 PTHR15856:SF27, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF12618 DUF3776, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00249 PHD, 1 hit
SM00333 TUDOR, 2 hits

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF57903 SSF57903, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS01359 ZF_PHD_1, 1 hit
PS00028 ZINC_FINGER_C2H2_1, 1 hit
PS50157 ZINC_FINGER_C2H2_2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 5 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9BVI0-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MTKHPPNRRG ISFEVGAQLE ARDRLKNWYP AHIEDIDYEE GKVLIHFKRW
60 70 80 90 100
NHRYDEWFCW DSPYLRPLEK IQLRKEGLHE EDGSSEFQIN EQVLACWSDC
110 120 130 140 150
RFYPAKVTAV NKDGTYTVKF YDGVVQTVKH IHVKAFSKDQ NIVGNARPKE
160 170 180 190 200
TDHKSLSSSP DKREKFKEQR KATVNVKKDK EDKPLKTEKR PKQPDKEGKL
210 220 230 240 250
ICSEKGKVSE KSLPKNEKED KENISENDRE YSGDAQVDKK PENDIVKSPQ
260 270 280 290 300
ENLREPKRKR GRPPSIAPTA VDSNSQTLQP ITLELRRRKI SKGCEVPLKR
310 320 330 340 350
PRLDKNSSQE KSKNYSENTD KDLSRRRSSR LSTNGTHEIL DPDLVVSDLV
360 370 380 390 400
DTDPLQDTLS STKESEEGQL KSALEAGQVS SALTCHSFGD GSGAAGLELN
410 420 430 440 450
CPSMGENTMK TEPTSPLVEL QEISTVEVTN TFKKTDDFGS SNAPAVDLDH
460 470 480 490 500
KFRCKVVDCL KFFRKAKLLH YHMKYFHGME KSLEPEESPG KRHVQTRGPS
510 520 530 540 550
ASDKPSQETL TRKRVSASSP TTKDKEKNKE KKFKEFVRVK PKKKKKKKKK
560 570 580 590 600
TKPECPCSEE ISDTSQEPSP PKAFAVTRCG SSHKPGVHMS PQLHGPESGH
610 620 630 640 650
HKGKVKALEE DNLSESSSES FLWSDDEYGQ DVDVTTNPDE ELDGDDRYDF
660 670 680 690 700
EVVRCICEVQ EENDFMIQCE ECQCWQHGVC MGLLEENVPE KYTCYVCQDP
710 720 730 740 750
PGQRPGFKYW YDKEWLSRGH MHGLAFLEEN YSHQNAKKIV ATHQLLGDVQ
760 770 780 790 800
RVIEVLHGLQ LKMSILQSRE HPDLPLWCQP WKQHSGEGRS HFRNIPVTDT
810 820 830 840 850
RSKEEAPSYR TLNGAVEKPR PLALPLPRSV EESYITSEHC YQKPRAYYPA
860 870 880 890 900
VEQKLVVETR GSALDDAVNP LHENGDDSLS PRLGWPLDQD RSKGDSDPKP
910 920 930 940 950
GSPKVKEYVS KKALPEEAPA RKLLDRGGEG LLSSQHQWQF NLLTHVESLQ
960 970 980 990 1000
DEVTHRMDSI EKELDVLESW LDYTGELEPP EPLARLPQLK HCIKQLLMDL
1010
GKVQQIALCC ST
Length:1,012
Mass (Da):115,386
Last modified:July 11, 2003 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i1CDBADC23D007503
GO
Isoform 2 (identifier: Q9BVI0-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     237-273: VDKKPENDIVKSPQENLREPKRKRGRPPSIAPTAVDS → KTRQTPFHSSYCCGFKLSNFATNNIGTEKKENIKRM
     274-1012: Missing.

Show »
Length:272
Mass (Da):31,856
Checksum:i11C579B3C0050A12
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 5 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
Q5JXL1Q5JXL1_HUMAN
PHD finger protein 20
PHF20
549Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
Q5JWZ0Q5JWZ0_HUMAN
PHD finger protein 20
PHF20
543Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F8WCQ1F8WCQ1_HUMAN
PHD finger protein 20
PHF20
103Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
B0QYY0B0QYY0_HUMAN
PHD finger protein 20
PHF20
154Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
B0QZ19B0QZ19_HUMAN
PHD finger protein 20
PHF20
64Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAF34184 differs from that shown. Reason: Frameshift at position 260.Curated
The sequence AAK19748 differs from that shown. Reason: Frameshift at positions 635, 653 and 655.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti221 – 222KE → QG in AAG49888 (PubMed:11703362).Curated2
Sequence conflicti226E → G in AAG49888 (PubMed:11703362).Curated1
Sequence conflicti372S → F in AAH80598 (PubMed:15489334).Curated1
Sequence conflicti516S → F in AAG49888 (PubMed:11703362).Curated1
Sequence conflicti532K → E in BAG37103 (PubMed:14702039).Curated1
Sequence conflicti671E → G in BAG37103 (PubMed:14702039).Curated1
Isoform 2 (identifier: Q9BVI0-2)
Sequence conflicti237 – 239KTR → KKTS in AAF34184 (PubMed:12097419).Curated3

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_051600605V → M1 PublicationCorresponds to variant dbSNP:rs17431878Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_007760237 – 273VDKKP…TAVDS → KTRQTPFHSSYCCGFKLSNF ATNNIGTEKKENIKRM in isoform 2. 1 PublicationAdd BLAST37
Alternative sequenceiVSP_007761274 – 1012Missing in isoform 2. 1 PublicationAdd BLAST739

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF220416 mRNA Translation: AAF34184.1 Frameshift.
AF348207 mRNA Translation: AAK19748.1 Frameshift.
AY027523 mRNA Translation: AAK13046.1
AK314503 mRNA Translation: BAG37103.1
AL078461 Genomic DNA No translation available.
AL109965 Genomic DNA No translation available.
CH471077 Genomic DNA Translation: EAW76153.1
CH471077 Genomic DNA Translation: EAW76155.1
CH471077 Genomic DNA Translation: EAW76156.1
CH471077 Genomic DNA Translation: EAW76157.1
BC048210 mRNA Translation: AAH48210.1
BC080598 mRNA Translation: AAH80598.1
BC093405 mRNA Translation: AAH93405.1
BC150178 mRNA Translation: AAI50179.1
AF258787 mRNA Translation: AAG49888.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS13268.1 [Q9BVI0-1]

NCBI Reference Sequences

More...
RefSeqi
NP_057520.2, NM_016436.4 [Q9BVI0-1]
XP_016883353.1, XM_017027864.1
XP_016883354.1, XM_017027865.1
XP_016883355.1, XM_017027866.1
XP_016883356.1, XM_017027867.1

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.517044

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000374012; ENSP00000363124; ENSG00000025293 [Q9BVI0-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
51230

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:51230

UCSC genome browser

More...
UCSCi
uc002xek.2 human [Q9BVI0-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF220416 mRNA Translation: AAF34184.1 Frameshift.
AF348207 mRNA Translation: AAK19748.1 Frameshift.
AY027523 mRNA Translation: AAK13046.1
AK314503 mRNA Translation: BAG37103.1
AL078461 Genomic DNA No translation available.
AL109965 Genomic DNA No translation available.
CH471077 Genomic DNA Translation: EAW76153.1
CH471077 Genomic DNA Translation: EAW76155.1
CH471077 Genomic DNA Translation: EAW76156.1
CH471077 Genomic DNA Translation: EAW76157.1
BC048210 mRNA Translation: AAH48210.1
BC080598 mRNA Translation: AAH80598.1
BC093405 mRNA Translation: AAH93405.1
BC150178 mRNA Translation: AAI50179.1
AF258787 mRNA Translation: AAG49888.1
CCDSiCCDS13268.1 [Q9BVI0-1]
RefSeqiNP_057520.2, NM_016436.4 [Q9BVI0-1]
XP_016883353.1, XM_017027864.1
XP_016883354.1, XM_017027865.1
XP_016883355.1, XM_017027866.1
XP_016883356.1, XM_017027867.1
UniGeneiHs.517044

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2LDMNMR-A84-147[»]
3P8DX-ray2.00A/B84-147[»]
3Q1JX-ray2.35A4-69[»]
3QIIX-ray2.30A83-150[»]
3SD4X-ray1.93A/B4-69[»]
5TABX-ray1.25A651-698[»]
5TBNNMR-A646-699[»]
ProteinModelPortaliQ9BVI0
SMRiQ9BVI0
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi119393, 19 interactors
ComplexPortaliCPX-809 NSL histone acetyltransferase complex
CORUMiQ9BVI0
IntActiQ9BVI0, 9 interactors
MINTiQ9BVI0
STRINGi9606.ENSP00000363124

PTM databases

iPTMnetiQ9BVI0
PhosphoSitePlusiQ9BVI0

Polymorphism and mutation databases

BioMutaiPHF20
DMDMi32699605

Proteomic databases

EPDiQ9BVI0
jPOSTiQ9BVI0
MaxQBiQ9BVI0
PaxDbiQ9BVI0
PeptideAtlasiQ9BVI0
PRIDEiQ9BVI0
ProteomicsDBi79207
79208 [Q9BVI0-2]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000374012; ENSP00000363124; ENSG00000025293 [Q9BVI0-1]
GeneIDi51230
KEGGihsa:51230
UCSCiuc002xek.2 human [Q9BVI0-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
51230
DisGeNETi51230
EuPathDBiHostDB:ENSG00000025293.15

GeneCards: human genes, protein and diseases

More...
GeneCardsi
PHF20
HGNCiHGNC:16098 PHF20
HPAiHPA029619
HPA029620
HPA029621
MIMi610335 gene
neXtProtiNX_Q9BVI0
OpenTargetsiENSG00000025293
PharmGKBiPA25644

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG410IMXB Eukaryota
ENOG410XX7Z LUCA
GeneTreeiENSGT00940000156477
HOVERGENiHBG053586
InParanoidiQ9BVI0
KOiK18402
OMAiDFSIHRR
OrthoDBi147824at2759
PhylomeDBiQ9BVI0
TreeFamiTF106475

Enzyme and pathway databases

ReactomeiR-HSA-3214847 HATs acetylate histones
R-HSA-6804757 Regulation of TP53 Degradation
R-HSA-6804759 Regulation of TP53 Activity through Association with Co-factors
R-HSA-69541 Stabilization of p53
SIGNORiQ9BVI0

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
PHF20 human
EvolutionaryTraceiQ9BVI0

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
PHF20

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
51230

Protein Ontology

More...
PROi
PR:Q9BVI0

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000025293 Expressed in 238 organ(s), highest expression level in endothelial cell
CleanExiHS_PHF20
ExpressionAtlasiQ9BVI0 baseline and differential
GenevisibleiQ9BVI0 HS

Family and domain databases

Gene3Di3.30.40.10, 1 hit
InterProiView protein in InterPro
IPR022255 DUF3776
IPR037915 PHF20
IPR002999 Tudor
IPR019786 Zinc_finger_PHD-type_CS
IPR013087 Znf_C2H2_type
IPR011011 Znf_FYVE_PHD
IPR001965 Znf_PHD
IPR013083 Znf_RING/FYVE/PHD
PANTHERiPTHR15856:SF27 PTHR15856:SF27, 1 hit
PfamiView protein in Pfam
PF12618 DUF3776, 1 hit
SMARTiView protein in SMART
SM00249 PHD, 1 hit
SM00333 TUDOR, 2 hits
SUPFAMiSSF57903 SSF57903, 1 hit
PROSITEiView protein in PROSITE
PS01359 ZF_PHD_1, 1 hit
PS00028 ZINC_FINGER_C2H2_1, 1 hit
PS50157 ZINC_FINGER_C2H2_2, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiPHF20_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9BVI0
Secondary accession number(s): A7E235
, B2RB56, E1P5S3, Q566Q2, Q5JWY9, Q66K49, Q9BWV4, Q9BXA3, Q9BZW3, Q9H421, Q9H4J6, Q9NZ22
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 11, 2003
Last sequence update: July 11, 2003
Last modified: January 16, 2019
This is version 172 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  2. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  4. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  5. Human chromosome 20
    Human chromosome 20: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again