Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 116 (13 Feb 2019)
Sequence version 1 (01 Jun 2001)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Ashwin

Gene

C2orf49

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Biological processi

Enzyme and pathway databases

BioCyc Collection of Pathway/Genome Databases

More...
BioCyci
MetaCyc:ENSG00000135974-MONOMER

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-6784531 tRNA processing in the nucleus

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Ashwin
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:C2orf49
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 2

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000135974.9

Human Gene Nomenclature Database

More...
HGNCi
HGNC:28772 C2orf49

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q9BVC5

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

Open Targets

More...
OpenTargetsi
ENSG00000135974

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA162379179

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
C2orf49

Domain mapping of disease mutations (DMDM)

More...
DMDMi
74733311

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002688591 – 232AshwinAdd BLAST232

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei112PhosphoserineCombined sources1
Modified residuei143PhosphoserineCombined sources1
Modified residuei182PhosphoserineCombined sources1
Modified residuei184PhosphoserineCombined sources1
Modified residuei189PhosphoserineCombined sources1
Modified residuei193PhosphoserineCombined sources1
Modified residuei197PhosphothreonineCombined sources1
Modified residuei198PhosphothreonineCombined sources1

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - PTMi

Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q9BVC5

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q9BVC5

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q9BVC5

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9BVC5

PeptideAtlas

More...
PeptideAtlasi
Q9BVC5

PRoteomics IDEntifications database

More...
PRIDEi
Q9BVC5

ProteomicsDB human proteome resource

More...
ProteomicsDBi
79197

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9BVC5

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9BVC5

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000135974 Expressed in 219 organ(s), highest expression level in female gonad

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q9BVC5 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9BVC5 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA043846
HPA060814

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Component of the tRNA-splicing ligase complex.2 Publications

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
122525, 13 interactors

CORUM comprehensive resource of mammalian protein complexes

More...
CORUMi
Q9BVC5

Protein interaction database and analysis system

More...
IntActi
Q9BVC5, 3 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000258457

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
Q9BVC5

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the ashwin family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IGF7 Eukaryota
ENOG4111XKJ LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000007488

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000034099

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG080774

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9BVC5

KEGG Orthology (KO)

More...
KOi
K15432

Identification of Orthologs from Complete Genome Data

More...
OMAi
KKKIQHV

Database of Orthologous Groups

More...
OrthoDBi
1299864at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9BVC5

TreeFam database of animal gene trees

More...
TreeFami
TF332084

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR024887 Ashwin

The PANTHER Classification System

More...
PANTHERi
PTHR28359 PTHR28359, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF15323 Ashwin, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9BVC5-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAGDVGGRSC TDSELLLHPE LLSQEFLLLT LEQKNIAVET DVRVNKDSLT
60 70 80 90 100
DLYVQHAIPL PQRDLPKNRW GKMMEKKREQ HEIKNETKRS STVDGLRKRP
110 120 130 140 150
LIVFDGSSTS TSIKVKKTEN GDNDRLKPPP QASFTSNAFR KLSNSSSSVS
160 170 180 190 200
PLILSSNLPV NNKTEHNNND AKQNHDLTHR KSPSGPVKSP PLSPVGTTPV
210 220 230
KLKRAAPKEE AEAMNNLKPP QAKRKIQHVT WP
Length:232
Mass (Da):25,858
Last modified:June 1, 2001 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i27A5611FA270FB3E
GO
Isoform 2 (identifier: Q9BVC5-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MRRLRVTTHASLRPSTSLPQRFLRGALWVADWGLLATTM
     131-172: Missing.

Note: No experimental confirmation available.
Show »
Length:228
Mass (Da):25,675
Checksum:i114F61B4181DA412
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
C9J4K0C9J4K0_HUMAN
Ashwin
C2orf49
190Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_029759185G → D1 PublicationCorresponds to variant dbSNP:rs28930676Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0543531M → MRRLRVTTHASLRPSTSLPQ RFLRGALWVADWGLLATTM in isoform 2. 1 Publication1
Alternative sequenceiVSP_054354131 – 172Missing in isoform 2. 1 PublicationAdd BLAST42

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AK127661 mRNA Translation: BAG54545.1
AK304268 mRNA Translation: BAG65131.1
AC012360 Genomic DNA Translation: AAY15011.1
BC001310 mRNA Translation: AAH01310.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS2068.1 [Q9BVC5-1]

NCBI Reference Sequences

More...
RefSeqi
NP_001273466.1, NM_001286537.1
NP_076998.1, NM_024093.2 [Q9BVC5-1]
XP_016860381.1, XM_017004892.1 [Q9BVC5-2]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.549577

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000258457; ENSP00000258457; ENSG00000135974 [Q9BVC5-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
79074

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:79074

UCSC genome browser

More...
UCSCi
uc002tcs.3 human [Q9BVC5-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK127661 mRNA Translation: BAG54545.1
AK304268 mRNA Translation: BAG65131.1
AC012360 Genomic DNA Translation: AAY15011.1
BC001310 mRNA Translation: AAH01310.1
CCDSiCCDS2068.1 [Q9BVC5-1]
RefSeqiNP_001273466.1, NM_001286537.1
NP_076998.1, NM_024093.2 [Q9BVC5-1]
XP_016860381.1, XM_017004892.1 [Q9BVC5-2]
UniGeneiHs.549577

3D structure databases

ProteinModelPortaliQ9BVC5
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi122525, 13 interactors
CORUMiQ9BVC5
IntActiQ9BVC5, 3 interactors
STRINGi9606.ENSP00000258457

PTM databases

iPTMnetiQ9BVC5
PhosphoSitePlusiQ9BVC5

Polymorphism and mutation databases

BioMutaiC2orf49
DMDMi74733311

Proteomic databases

EPDiQ9BVC5
jPOSTiQ9BVC5
MaxQBiQ9BVC5
PaxDbiQ9BVC5
PeptideAtlasiQ9BVC5
PRIDEiQ9BVC5
ProteomicsDBi79197

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
79074
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000258457; ENSP00000258457; ENSG00000135974 [Q9BVC5-1]
GeneIDi79074
KEGGihsa:79074
UCSCiuc002tcs.3 human [Q9BVC5-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
79074
EuPathDBiHostDB:ENSG00000135974.9

GeneCards: human genes, protein and diseases

More...
GeneCardsi
C2orf49
HGNCiHGNC:28772 C2orf49
HPAiHPA043846
HPA060814
neXtProtiNX_Q9BVC5
OpenTargetsiENSG00000135974
PharmGKBiPA162379179

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG410IGF7 Eukaryota
ENOG4111XKJ LUCA
GeneTreeiENSGT00390000007488
HOGENOMiHOG000034099
HOVERGENiHBG080774
InParanoidiQ9BVC5
KOiK15432
OMAiKKKIQHV
OrthoDBi1299864at2759
PhylomeDBiQ9BVC5
TreeFamiTF332084

Enzyme and pathway databases

BioCyciMetaCyc:ENSG00000135974-MONOMER
ReactomeiR-HSA-6784531 tRNA processing in the nucleus

Miscellaneous databases

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
79074

Protein Ontology

More...
PROi
PR:Q9BVC5

Gene expression databases

BgeeiENSG00000135974 Expressed in 219 organ(s), highest expression level in female gonad
ExpressionAtlasiQ9BVC5 baseline and differential
GenevisibleiQ9BVC5 HS

Family and domain databases

InterProiView protein in InterPro
IPR024887 Ashwin
PANTHERiPTHR28359 PTHR28359, 1 hit
PfamiView protein in Pfam
PF15323 Ashwin, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiASHWN_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9BVC5
Secondary accession number(s): B3KXN3, B4E2G9
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: December 12, 2006
Last sequence update: June 1, 2001
Last modified: February 13, 2019
This is version 116 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again