Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Due to a server migration, the UniProt 'ID mapping', 'Peptide search' and 'community bibliography submission' tools will not be available on the 19th April 2021 during the morning (EST).
Entry version 125 (07 Apr 2021)
Sequence version 2 (15 May 2007)
Previous versions | rss
Add a publicationFeedback
Protein

Methyltransferase-like protein 22

Gene

METTL22

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Protein N-lysine methyltransferase. In vitro methylates KIN.1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionMethyltransferase, Transferase
LigandS-adenosyl-L-methionine

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...
PathwayCommonsi
Q9BUU2

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-8876725, Protein methylation

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Methyltransferase-like protein 22 (EC:2.1.1.-)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:METTL22
Synonyms:C16orf68
ORF Names:LP8272
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 16

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:28368, METTL22

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
615261, gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q9BUU2

Eukaryotic Pathogen, Vector and Host Database Resources

More...
VEuPathDBi
HostDB:ENSG00000067365.14

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Keywords - Cellular componenti

Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

Open Targets

More...
OpenTargetsi
ENSG00000067365

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA144596479

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q9BUU2, Tdark

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
METTL22

Domain mapping of disease mutations (DMDM)

More...
DMDMi
147639349

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002865911 – 404Methyltransferase-like protein 22Add BLAST404

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei132PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q9BUU2

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q9BUU2

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q9BUU2

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q9BUU2

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9BUU2

PeptideAtlas

More...
PeptideAtlasi
Q9BUU2

PRoteomics IDEntifications database

More...
PRIDEi
Q9BUU2

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
79130 [Q9BUU2-1]
79131 [Q9BUU2-2]
79132 [Q9BUU2-3]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9BUU2

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9BUU2

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000067365, Expressed in testis and 200 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q9BUU2, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9BUU2, HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
ENSG00000067365, Low tissue specificity

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with members of the heat shock protein 90 and 70 families; these proteins probably are methylation substrates.

1 Publication

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
122539, 24 interactors

Protein interaction database and analysis system

More...
IntActi
Q9BUU2, 3 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000371345

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q9BUU2, protein

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG2497, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00510000048539

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_097585_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9BUU2

Identification of Orthologs from Complete Genome Data

More...
OMAi
KNACTAL

Database of Orthologous Groups

More...
OrthoDBi
1612133at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9BUU2

TreeFam database of animal gene trees

More...
TreeFami
TF324844

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR019410, Methyltransf_16
IPR038899, METTL22
IPR029063, SAM-dependent_MTases

The PANTHER Classification System

More...
PANTHERi
PTHR23108, PTHR23108, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF10294, Methyltransf_16, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF53335, SSF53335, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 8 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9BUU2-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MVQLAPAAAM DEVTFRSDTV LSDVHLYTPN HRHLMVRLNS VGQPVFLSQF
60 70 80 90 100
KLLWSQDSWT DSGAKGGSHR DVHTKEPPSA ETGSTGSPPG SGHGNEGFSL
110 120 130 140 150
QAGTDTTGQE VAEAQLDEDG DLDVVRRPRA ASDSNPAGPL RDKVHPMILA
160 170 180 190 200
QEEDDVLGEE AQGSPHDIIR IEHTMATPLE DVGKQVWRGA LLLADYILFR
210 220 230 240 250
QDLFRGCTAL ELGAGTGLAS IIAATMARTV YCTDVGADLL SMCQRNIALN
260 270 280 290 300
SHLAATGGGI VRVKELDWLK DDLCTDPKVP FSWSQEEISD LYDHTTILFA
310 320 330 340 350
AEVFYDDDLT DAVFKTLSRL AHRLKNACTA ILSVEKRLNF TLRHLDVTCE
360 370 380 390 400
AYDHFRSCLH ALEQLADGKL RFVVEPVEAS FPQLLVYERL QQLELWKIIA

EPVT
Length:404
Mass (Da):44,486
Last modified:May 15, 2007 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i049135469B80D6F9
GO
Isoform 2 (identifier: Q9BUU2-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     172-205: EHTMATPLEDVGKQVWRGALLLADYILFRQDLFR → GVAGRPAPGRLHPVPTGPLPRMYSAGARGRHGAR
     206-404: Missing.

Show »
Length:205
Mass (Da):21,813
Checksum:i549514E9F88AA252
GO
Isoform 3 (identifier: Q9BUU2-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-225: Missing.

Show »
Length:179
Mass (Da):20,389
Checksum:i286526061CCA0EEE
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 8 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H3BTF5H3BTF5_HUMAN
Methyltransferase-like protein 22
METTL22
348Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
I3L483I3L483_HUMAN
Methyltransferase-like protein 22
METTL22
165Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
I3L3I8I3L3I8_HUMAN
Methyltransferase-like protein 22
METTL22
103Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
I3L2J5I3L2J5_HUMAN
Methyltransferase-like protein 22
METTL22
154Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H3BTR2H3BTR2_HUMAN
Methyltransferase-like protein 22
METTL22
70Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H3BSA9H3BSA9_HUMAN
Methyltransferase-like protein 22
METTL22
16Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H3BTI6H3BTI6_HUMAN
Methyltransferase-like protein 22
METTL22
46Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H3BV20H3BV20_HUMAN
Methyltransferase-like protein 22
METTL22
47Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_03213459W → S. Corresponds to variant dbSNP:rs2270286Ensembl.1
Natural variantiVAR_032135219A → T. Corresponds to variant dbSNP:rs2302607Ensembl.1
Natural variantiVAR_059623366A → T1 PublicationCorresponds to variant dbSNP:rs1731000Ensembl.1
Natural variantiVAR_061617375E → K. Corresponds to variant dbSNP:rs55747257Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0251061 – 225Missing in isoform 3. 1 PublicationAdd BLAST225
Alternative sequenceiVSP_025107172 – 205EHTMA…QDLFR → GVAGRPAPGRLHPVPTGPLP RMYSAGARGRHGAR in isoform 2. 2 PublicationsAdd BLAST34
Alternative sequenceiVSP_025108206 – 404Missing in isoform 2. 2 PublicationsAdd BLAST199

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AK022495 mRNA Translation: BAB14058.1
AK315383 mRNA Translation: BAG37776.1
AC007224 Genomic DNA No translation available.
AC138420 Genomic DNA No translation available.
AY203956 mRNA Translation: AAP34479.1
CH471112 Genomic DNA Translation: EAW85210.1
CH471112 Genomic DNA Translation: EAW85211.1
BC001908 mRNA Translation: AAH01908.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS10533.2 [Q9BUU2-1]

NCBI Reference Sequences

More...
RefSeqi
NP_077014.3, NM_024109.3 [Q9BUU2-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000163678; ENSP00000163678; ENSG00000067365 [Q9BUU2-2]
ENST00000381920; ENSP00000371345; ENSG00000067365 [Q9BUU2-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
79091

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:79091

UCSC genome browser

More...
UCSCi
uc002czb.4, human [Q9BUU2-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK022495 mRNA Translation: BAB14058.1
AK315383 mRNA Translation: BAG37776.1
AC007224 Genomic DNA No translation available.
AC138420 Genomic DNA No translation available.
AY203956 mRNA Translation: AAP34479.1
CH471112 Genomic DNA Translation: EAW85210.1
CH471112 Genomic DNA Translation: EAW85211.1
BC001908 mRNA Translation: AAH01908.1
CCDSiCCDS10533.2 [Q9BUU2-1]
RefSeqiNP_077014.3, NM_024109.3 [Q9BUU2-1]

3D structure databases

Database of comparative protein structure models

More...
ModBasei
Search...

SWISS-MODEL Interactive Workspace

More...
SWISS-MODEL-Workspacei
Submit a new modelling project...

Protein-protein interaction databases

BioGRIDi122539, 24 interactors
IntActiQ9BUU2, 3 interactors
STRINGi9606.ENSP00000371345

PTM databases

iPTMnetiQ9BUU2
PhosphoSitePlusiQ9BUU2

Genetic variation databases

BioMutaiMETTL22
DMDMi147639349

Proteomic databases

EPDiQ9BUU2
jPOSTiQ9BUU2
MassIVEiQ9BUU2
MaxQBiQ9BUU2
PaxDbiQ9BUU2
PeptideAtlasiQ9BUU2
PRIDEiQ9BUU2
ProteomicsDBi79130 [Q9BUU2-1]
79131 [Q9BUU2-2]
79132 [Q9BUU2-3]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
51872, 33 antibodies

Genome annotation databases

EnsembliENST00000163678; ENSP00000163678; ENSG00000067365 [Q9BUU2-2]
ENST00000381920; ENSP00000371345; ENSG00000067365 [Q9BUU2-1]
GeneIDi79091
KEGGihsa:79091
UCSCiuc002czb.4, human [Q9BUU2-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
79091

GeneCards: human genes, protein and diseases

More...
GeneCardsi
METTL22
HGNCiHGNC:28368, METTL22
HPAiENSG00000067365, Low tissue specificity
MIMi615261, gene
neXtProtiNX_Q9BUU2
OpenTargetsiENSG00000067365
PharmGKBiPA144596479
VEuPathDBiHostDB:ENSG00000067365.14

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG2497, Eukaryota
GeneTreeiENSGT00510000048539
HOGENOMiCLU_097585_0_0_1
InParanoidiQ9BUU2
OMAiKNACTAL
OrthoDBi1612133at2759
PhylomeDBiQ9BUU2
TreeFamiTF324844

Enzyme and pathway databases

PathwayCommonsiQ9BUU2
ReactomeiR-HSA-8876725, Protein methylation

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
79091, 1 hit in 990 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
METTL22, human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
79091
PharosiQ9BUU2, Tdark

Protein Ontology

More...
PROi
PR:Q9BUU2
RNActiQ9BUU2, protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000067365, Expressed in testis and 200 other tissues
ExpressionAtlasiQ9BUU2, baseline and differential
GenevisibleiQ9BUU2, HS

Family and domain databases

InterProiView protein in InterPro
IPR019410, Methyltransf_16
IPR038899, METTL22
IPR029063, SAM-dependent_MTases
PANTHERiPTHR23108, PTHR23108, 1 hit
PfamiView protein in Pfam
PF10294, Methyltransf_16, 1 hit
SUPFAMiSSF53335, SSF53335, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiMET22_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9BUU2
Secondary accession number(s): B2RD29
, D3DUF2, Q6XYB4, Q9HA03
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 15, 2007
Last sequence update: May 15, 2007
Last modified: April 7, 2021
This is version 125 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Human chromosome 16
    Human chromosome 16: entries, gene names and cross-references to MIM
  2. Human entries with genetic variants
    List of human entries with genetic variants
  3. Human variants curated from literature reports
    Index of human variants curated from literature reports
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again