Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 141 (16 Oct 2019)
Sequence version 2 (01 Mar 2004)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Lipase maturation factor 2

Gene

LMF2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:4 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Involved in the maturation of specific proteins in the endoplasmic reticulum. May be required for maturation and transport of active lipoprotein lipase (LPL) through the secretory pathway (By similarity).By similarity

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Biological processi

  • protein maturation Source: GO_Central

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-8963889 Assembly of active LPL and LIPC lipase complexes

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Lipase maturation factor 2
Alternative name(s):
Transmembrane protein 112B
Transmembrane protein 153
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:LMF2
Synonyms:TMEM112B, TMEM153
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 22

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:25096 LMF2

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q9BU23

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei10 – 30HelicalSequence analysisAdd BLAST21
Transmembranei78 – 98HelicalSequence analysisAdd BLAST21
Transmembranei102 – 122HelicalSequence analysisAdd BLAST21
Transmembranei123 – 143HelicalSequence analysisAdd BLAST21
Transmembranei165 – 185HelicalSequence analysisAdd BLAST21
Transmembranei227 – 247HelicalSequence analysisAdd BLAST21
Transmembranei259 – 279HelicalSequence analysisAdd BLAST21
Transmembranei310 – 330HelicalSequence analysisAdd BLAST21
Transmembranei364 – 384HelicalSequence analysisAdd BLAST21
Transmembranei399 – 419HelicalSequence analysisAdd BLAST21
Transmembranei637 – 657HelicalSequence analysisAdd BLAST21

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Endoplasmic reticulum, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
91289

Open Targets

More...
OpenTargetsi
ENSG00000100258

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA162394144

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q9BU23

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
LMF2

Domain mapping of disease mutations (DMDM)

More...
DMDMi
74733167

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003245101 – 707Lipase maturation factor 2Add BLAST707

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi489N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi616N-linked (GlcNAc...) asparagineSequence analysis1

Keywords - PTMi

Glycoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q9BU23

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q9BU23

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q9BU23

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q9BU23

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9BU23

PeptideAtlas

More...
PeptideAtlasi
Q9BU23

PRoteomics IDEntifications database

More...
PRIDEi
Q9BU23

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
79046 [Q9BU23-1]
79047 [Q9BU23-2]
79048 [Q9BU23-3]

PTM databases

GlyConnect protein glycosylation platform

More...
GlyConnecti
1457

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9BU23

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9BU23

SwissPalm database of S-palmitoylation events

More...
SwissPalmi
Q9BU23

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000100258 Expressed in 197 organ(s), highest expression level in body of pancreas

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9BU23 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA062626

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
124811, 43 interactors

Protein interaction database and analysis system

More...
IntActi
Q9BU23, 25 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000424381

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the lipase maturation factor family.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IFKQ Eukaryota
ENOG410XPYW LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00530000063702

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000019333

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9BU23

Identification of Orthologs from Complete Genome Data

More...
OMAi
YKPGNVN

Database of Orthologous Groups

More...
OrthoDBi
759759at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9BU23

TreeFam database of animal gene trees

More...
TreeFami
TF314339

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR009613 LMF

The PANTHER Classification System

More...
PANTHERi
PTHR14463 PTHR14463, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF06762 LMF1, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: Q9BU23-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAGSRLPRQL FLQGVAAVFM FAFASLYTQI PGLYGPEGIL PARRTLRPQG
60 70 80 90 100
KGRWQQLWET PTLLWEAPRL GLDTAQGLEL LSLLGALVAL GALLLSPLRH
110 120 130 140 150
PVIYLLLWAA YLSACQVGQV FLYFQWDSLL LETGFLAVLV APLRPASHRK
160 170 180 190 200
EAPQGRQAGA LPHEDLPFWL VRWLLFRLMF ASGVVKLTSR CPAWWGLTAL
210 220 230 240 250
TYHYETQCLP TPAAWFAHHL PVWLHKLSVV ATFLIEIAVP PLFFAPIRRL
260 270 280 290 300
RLAAFYSQVL LQVLIIITGN YNFFNLMTLV LTTALLDDQH LAAEPGHGSR
310 320 330 340 350
KKTATSWPKA LLATLSLLLE LAVYGLLAYG TVHYFGLEVD WQQRTIHSRT
360 370 380 390 400
TFTFHQFSQW LKTLTLPTVW LGVASLVWEL LSALWRWTQV RGWLRKLSAV
410 420 430 440 450
VQLSLVGTAT VALFLISLVP YSYVEPGTHG RLWTGAHRLF GAVEHLQLAN
460 470 480 490 500
SYGLFRRMTG LGGRPEVVLE GSYDGHHWTE IEFMYKPGNL SRPPPVVVPH
510 520 530 540 550
QPRLDWQMWF AALGPHTHSP WFTSLVLRLL QGKEPVIRLV QSQVARYPFH
560 570 580 590 600
KQPPTYVRAQ RYKYWFSQPG EQGQWWRRQW VEEFFPSVSL GDPTLETLLR
610 620 630 640 650
QFGLQEKSPP RTRSANSTLA QALHWTRSQL SPLEAPALLW GLLMAVGAVR
660 670 680 690 700
FVQALLAPCS LRSSPLAPVS GEKRRPASQK DSGAASEQAT AAPNPCSSSS

RTTRRKK
Length:707
Mass (Da):79,698
Last modified:March 1, 2004 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iF3599AE9549C7E62
GO
Isoform 2 (identifier: Q9BU23-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-31: MAGSRLPRQLFLQGVAAVFMFAFASLYTQIP → MTCPPT

Show »
Length:682
Mass (Da):76,915
Checksum:i232E393DC1F5A51D
GO
Isoform 3 (identifier: Q9BU23-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     392-504: Missing.

Note: No experimental confirmation available.
Show »
Length:594
Mass (Da):67,156
Checksum:i03FAAE2CF75D5BAF
GO

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAB03346 differs from that shown. Reason: Erroneous gene model prediction.Curated
The sequence BAC85437 differs from that shown. Chimeric cDNA.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti571E → G in BAC85437 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_03980368P → L in a breast cancer sample; somatic mutation. 1 PublicationCorresponds to variant dbSNP:rs376748648Ensembl.1
Natural variantiVAR_039804479T → M. Corresponds to variant dbSNP:rs8136495Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0322541 – 31MAGSR…YTQIP → MTCPPT in isoform 2. 1 PublicationAdd BLAST31
Alternative sequenceiVSP_032255392 – 504Missing in isoform 3. 1 PublicationAdd BLAST113

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
CR456605 mRNA Translation: CAG30491.1
U62317 Genomic DNA Translation: AAB03346.1 Sequence problems.
BC002942 mRNA Translation: AAH02942.2
BC014652 mRNA Translation: AAH14652.1
BC021143 mRNA Translation: AAH21143.1
AK130818 mRNA Translation: BAC85437.1 Sequence problems.

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS14093.2 [Q9BU23-1]
CCDS87035.1 [Q9BU23-2]

NCBI Reference Sequences

More...
RefSeqi
NP_149977.2, NM_033200.2 [Q9BU23-1]
XP_005262012.1, XM_005261955.3

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000216080; ENSP00000216080; ENSG00000100258 [Q9BU23-2]
ENST00000474879; ENSP00000424381; ENSG00000100258 [Q9BU23-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
91289

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:91289

UCSC genome browser

More...
UCSCi
uc003blo.3 human [Q9BU23-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
CR456605 mRNA Translation: CAG30491.1
U62317 Genomic DNA Translation: AAB03346.1 Sequence problems.
BC002942 mRNA Translation: AAH02942.2
BC014652 mRNA Translation: AAH14652.1
BC021143 mRNA Translation: AAH21143.1
AK130818 mRNA Translation: BAC85437.1 Sequence problems.
CCDSiCCDS14093.2 [Q9BU23-1]
CCDS87035.1 [Q9BU23-2]
RefSeqiNP_149977.2, NM_033200.2 [Q9BU23-1]
XP_005262012.1, XM_005261955.3

3D structure databases

Database of comparative protein structure models

More...
ModBasei
Search...

SWISS-MODEL Interactive Workspace

More...
SWISS-MODEL-Workspacei
Submit a new modelling project...

Protein-protein interaction databases

BioGridi124811, 43 interactors
IntActiQ9BU23, 25 interactors
STRINGi9606.ENSP00000424381

PTM databases

GlyConnecti1457
iPTMnetiQ9BU23
PhosphoSitePlusiQ9BU23
SwissPalmiQ9BU23

Polymorphism and mutation databases

BioMutaiLMF2
DMDMi74733167

Proteomic databases

EPDiQ9BU23
jPOSTiQ9BU23
MassIVEiQ9BU23
MaxQBiQ9BU23
PaxDbiQ9BU23
PeptideAtlasiQ9BU23
PRIDEiQ9BU23
ProteomicsDBi79046 [Q9BU23-1]
79047 [Q9BU23-2]
79048 [Q9BU23-3]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
91289

Genome annotation databases

EnsembliENST00000216080; ENSP00000216080; ENSG00000100258 [Q9BU23-2]
ENST00000474879; ENSP00000424381; ENSG00000100258 [Q9BU23-1]
GeneIDi91289
KEGGihsa:91289
UCSCiuc003blo.3 human [Q9BU23-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
91289
DisGeNETi91289

GeneCards: human genes, protein and diseases

More...
GeneCardsi
LMF2
HGNCiHGNC:25096 LMF2
HPAiHPA062626
neXtProtiNX_Q9BU23
OpenTargetsiENSG00000100258
PharmGKBiPA162394144

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG410IFKQ Eukaryota
ENOG410XPYW LUCA
GeneTreeiENSGT00530000063702
HOGENOMiHOG000019333
InParanoidiQ9BU23
OMAiYKPGNVN
OrthoDBi759759at2759
PhylomeDBiQ9BU23
TreeFamiTF314339

Enzyme and pathway databases

ReactomeiR-HSA-8963889 Assembly of active LPL and LIPC lipase complexes

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
LMF2 human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
91289
PharosiQ9BU23

Protein Ontology

More...
PROi
PR:Q9BU23

Gene expression databases

BgeeiENSG00000100258 Expressed in 197 organ(s), highest expression level in body of pancreas
GenevisibleiQ9BU23 HS

Family and domain databases

InterProiView protein in InterPro
IPR009613 LMF
PANTHERiPTHR14463 PTHR14463, 1 hit
PfamiView protein in Pfam
PF06762 LMF1, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiLMF2_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9BU23
Secondary accession number(s): A6NEZ0
, Q13392, Q6ZNR2, Q8WU74, Q96C62
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: March 18, 2008
Last sequence update: March 1, 2004
Last modified: October 16, 2019
This is version 141 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  3. Human chromosome 22
    Human chromosome 22: entries, gene names and cross-references to MIM
  4. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again