Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Zinc finger protein 692

Gene

ZNF692

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

May be involved in transcriptional regulation.

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri328 – 353C2H2-type 1PROSITE-ProRule annotationAdd BLAST26
Zinc fingeri359 – 383C2H2-type 2PROSITE-ProRule annotationAdd BLAST25
Zinc fingeri389 – 411C2H2-type 3PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri417 – 439C2H2-type 4PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri448 – 471C2H2-type 5PROSITE-ProRule annotationAdd BLAST24

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionDNA-binding
Biological processTranscription, Transcription regulation
LigandMetal-binding, Zinc

Enzyme and pathway databases

ReactomeiR-HSA-212436 Generic Transcription Pathway
SIGNORiQ9BU19

Names & Taxonomyi

Protein namesi
Recommended name:
Zinc finger protein 692
Gene namesi
Name:ZNF692
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 1

Organism-specific databases

EuPathDBiHostDB:ENSG00000171163.15
HGNCiHGNC:26049 ZNF692
MIMi617758 gene
neXtProtiNX_Q9BU19

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000171163
PharmGKBiPA142670491

Polymorphism and mutation databases

BioMutaiZNF692
DMDMi74761262

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002340141 – 519Zinc finger protein 692Add BLAST519

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei162PhosphoserineCombined sources1
Modified residuei231PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiQ9BU19
PaxDbiQ9BU19
PeptideAtlasiQ9BU19
PRIDEiQ9BU19
ProteomicsDBi79040
79041 [Q9BU19-2]
79042 [Q9BU19-3]
79043 [Q9BU19-4]
79044 [Q9BU19-5]
TopDownProteomicsiQ9BU19-3 [Q9BU19-3]

PTM databases

iPTMnetiQ9BU19
PhosphoSitePlusiQ9BU19

Expressioni

Gene expression databases

BgeeiENSG00000171163 Expressed in 218 organ(s), highest expression level in right hemisphere of cerebellum
CleanExiHS_ZNF692
ExpressionAtlasiQ9BU19 baseline and differential
GenevisibleiQ9BU19 HS

Organism-specific databases

HPAiHPA059337
HPA062792

Interactioni

Protein-protein interaction databases

BioGridi120789, 37 interactors
IntActiQ9BU19, 1 interactor
STRINGi9606.ENSP00000391200

Structurei

Secondary structure

1519
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

ProteinModelPortaliQ9BU19
SMRiQ9BU19
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ9BU19

Family & Domainsi

Sequence similaritiesi

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri328 – 353C2H2-type 1PROSITE-ProRule annotationAdd BLAST26
Zinc fingeri359 – 383C2H2-type 2PROSITE-ProRule annotationAdd BLAST25
Zinc fingeri389 – 411C2H2-type 3PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri417 – 439C2H2-type 4PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri448 – 471C2H2-type 5PROSITE-ProRule annotationAdd BLAST24

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

eggNOGiKOG1721 Eukaryota
COG5048 LUCA
GeneTreeiENSGT00530000063153
HOGENOMiHOG000039991
HOVERGENiHBG057936
InParanoidiQ9BU19
OMAiWCPEARS
OrthoDBiEOG091G03R1
PhylomeDBiQ9BU19
TreeFamiTF332664

Family and domain databases

InterProiView protein in InterPro
IPR036236 Znf_C2H2_sf
IPR013087 Znf_C2H2_type
PfamiView protein in Pfam
PF00096 zf-C2H2, 4 hits
SMARTiView protein in SMART
SM00355 ZnF_C2H2, 5 hits
SUPFAMiSSF57667 SSF57667, 3 hits
PROSITEiView protein in PROSITE
PS00028 ZINC_FINGER_C2H2_1, 5 hits
PS50157 ZINC_FINGER_C2H2_2, 5 hits

Sequences (5+)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 5 described isoforms and 7 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9BU19-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MASSPAVDVS CRRREKRRQL DARRSKCRIR LGGHMEQWCL LKERLGFSLH
60 70 80 90 100
SQLAKFLLDR YTSSGCVLCA GPEPLPPKGL QYLVLLSHAH SRECSLVPGL
110 120 130 140 150
RGPGGQDGGL VWECSAGHTF SWGPSLSPTP SEAPKPASLP HTTRRSWCSE
160 170 180 190 200
ATSGQELADL ESEHDERTQE ARLPRRVGPP PETFPPPGEE EGEEEEDNDE
210 220 230 240 250
DEEEMLSDAS LWTYSSSPDD SEPDAPRLLP SPVTCTPKEG ETPPAPAALS
260 270 280 290 300
SPLAVPALSA SSLSSRAPPP AEVRVQPQLS RTPQAAQQTE ALASTGSQAQ
310 320 330 340 350
SAPTPAWDED TAQIGPKRIR KAAKRELMPC DFPGCGRIFS NRQYLNHHKK
360 370 380 390 400
YQHIHQKSFS CPEPACGKSF NFKKHLKEHM KLHSDTRDYI CEFCARSFRT
410 420 430 440 450
SSNLVIHRRI HTGEKPLQCE ICGFTCRQKA SLNWHQRKHA ETVAALRFPC
460 470 480 490 500
EFCGKRFEKP DSVAAHRSKS HPALLLAPQE SPSGPLEPCP SISAPGPLGS
510
SEGSRPSASP QAPTLLPQQ
Length:519
Mass (Da):56,968
Last modified:June 1, 2001 - v1
Checksum:iDEFAEF73C910619E
GO
Isoform 2 (identifier: Q9BU19-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     175-220: RRVGPPPETFPPPGEEEGEEEEDNDEDEEEMLSDASLWTYSSSPDD → S

Note: No experimental confirmation available.
Show »
Length:474
Mass (Da):51,876
Checksum:iD550C5B21F03C12F
GO
Isoform 3 (identifier: Q9BU19-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     88-259: Missing.

Show »
Length:347
Mass (Da):38,643
Checksum:i8C92016FCA82AAE3
GO
Isoform 4 (identifier: Q9BU19-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     61-96: YTSSGCVLCAGPEPLPPKGLQYLVLLSHAHSRECSL → ACPAALFHPQVSHFTRTACVTCGLRGSCSPPHGLSE
     97-519: Missing.

Note: No experimental confirmation available.
Show »
Length:96
Mass (Da):10,819
Checksum:i6D555AC70BA6CF00
GO
Isoform 5 (identifier: Q9BU19-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MPLVHM

Note: No experimental confirmation available.
Show »
Length:524
Mass (Da):57,546
Checksum:i5A64D0C5F805388F
GO

Computationally mapped potential isoform sequencesi

There are 7 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H0YDF5H0YDF5_HUMAN
Zinc finger protein 692
ZNF692
79Annotation score:
H0YCH4H0YCH4_HUMAN
Zinc finger protein 692
ZNF692
273Annotation score:
E7ET73E7ET73_HUMAN
Zinc finger protein 692
ZNF692
105Annotation score:
E9PRH5E9PRH5_HUMAN
Zinc finger protein 692
ZNF692
132Annotation score:
H0YEY1H0YEY1_HUMAN
Zinc finger protein 692
ZNF692
164Annotation score:
E9PLQ7E9PLQ7_HUMAN
Zinc finger protein 692
ZNF692
69Annotation score:
E9PLQ5E9PLQ5_HUMAN
Zinc finger protein 692
ZNF692
80Annotation score:

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti373K → R in BAA91490 (PubMed:14702039).Curated1
Sequence conflicti401S → G in BAA91239 (PubMed:14702039).Curated1
Sequence conflicti435H → R in BAA91490 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_033590230P → R1 PublicationCorresponds to variant dbSNP:rs13313088Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0430251M → MPLVHM in isoform 5. 1 Publication1
Alternative sequenceiVSP_01818561 – 96YTSSG…RECSL → ACPAALFHPQVSHFTRTACV TCGLRGSCSPPHGLSE in isoform 4. 1 PublicationAdd BLAST36
Alternative sequenceiVSP_01818688 – 259Missing in isoform 3. 1 PublicationAdd BLAST172
Alternative sequenceiVSP_01818797 – 519Missing in isoform 4. 1 PublicationAdd BLAST423
Alternative sequenceiVSP_018188175 – 220RRVGP…SSPDD → S in isoform 2. 1 PublicationAdd BLAST46

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK000538 mRNA Translation: BAA91239.1
AK001070 mRNA Translation: BAA91490.1
AK302187 mRNA Translation: BAG63552.1
AL133100 mRNA Translation: CAB61410.2
AL672291 Genomic DNA No translation available.
BC002948 mRNA Translation: AAH02948.1
AF256175 Transcribed RNA Translation: AAG15327.1
CCDSiCCDS31127.1 [Q9BU19-1]
CCDS44348.1 [Q9BU19-5]
CCDS53487.1 [Q9BU19-2]
PIRiT42682
RefSeqiNP_001129508.1, NM_001136036.2 [Q9BU19-5]
NP_001180257.1, NM_001193328.1 [Q9BU19-2]
NP_060335.2, NM_017865.3 [Q9BU19-1]
XP_011542524.1, XM_011544222.1 [Q9BU19-1]
UniGeneiHs.377705

Genome annotation databases

EnsembliENST00000306601; ENSP00000305483; ENSG00000171163 [Q9BU19-1]
ENST00000366471; ENSP00000355427; ENSG00000171163 [Q9BU19-2]
ENST00000451251; ENSP00000391200; ENSG00000171163 [Q9BU19-5]
ENST00000463519; ENSP00000436308; ENSG00000171163 [Q9BU19-4]
GeneIDi55657
KEGGihsa:55657
UCSCiuc001ifc.3 human [Q9BU19-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK000538 mRNA Translation: BAA91239.1
AK001070 mRNA Translation: BAA91490.1
AK302187 mRNA Translation: BAG63552.1
AL133100 mRNA Translation: CAB61410.2
AL672291 Genomic DNA No translation available.
BC002948 mRNA Translation: AAH02948.1
AF256175 Transcribed RNA Translation: AAG15327.1
CCDSiCCDS31127.1 [Q9BU19-1]
CCDS44348.1 [Q9BU19-5]
CCDS53487.1 [Q9BU19-2]
PIRiT42682
RefSeqiNP_001129508.1, NM_001136036.2 [Q9BU19-5]
NP_001180257.1, NM_001193328.1 [Q9BU19-2]
NP_060335.2, NM_017865.3 [Q9BU19-1]
XP_011542524.1, XM_011544222.1 [Q9BU19-1]
UniGeneiHs.377705

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2D9HNMR-A417-481[»]
2DLKNMR-A328-393[»]
ProteinModelPortaliQ9BU19
SMRiQ9BU19
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi120789, 37 interactors
IntActiQ9BU19, 1 interactor
STRINGi9606.ENSP00000391200

PTM databases

iPTMnetiQ9BU19
PhosphoSitePlusiQ9BU19

Polymorphism and mutation databases

BioMutaiZNF692
DMDMi74761262

Proteomic databases

MaxQBiQ9BU19
PaxDbiQ9BU19
PeptideAtlasiQ9BU19
PRIDEiQ9BU19
ProteomicsDBi79040
79041 [Q9BU19-2]
79042 [Q9BU19-3]
79043 [Q9BU19-4]
79044 [Q9BU19-5]
TopDownProteomicsiQ9BU19-3 [Q9BU19-3]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000306601; ENSP00000305483; ENSG00000171163 [Q9BU19-1]
ENST00000366471; ENSP00000355427; ENSG00000171163 [Q9BU19-2]
ENST00000451251; ENSP00000391200; ENSG00000171163 [Q9BU19-5]
ENST00000463519; ENSP00000436308; ENSG00000171163 [Q9BU19-4]
GeneIDi55657
KEGGihsa:55657
UCSCiuc001ifc.3 human [Q9BU19-1]

Organism-specific databases

CTDi55657
EuPathDBiHostDB:ENSG00000171163.15
GeneCardsiZNF692
HGNCiHGNC:26049 ZNF692
HPAiHPA059337
HPA062792
MIMi617758 gene
neXtProtiNX_Q9BU19
OpenTargetsiENSG00000171163
PharmGKBiPA142670491
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG1721 Eukaryota
COG5048 LUCA
GeneTreeiENSGT00530000063153
HOGENOMiHOG000039991
HOVERGENiHBG057936
InParanoidiQ9BU19
OMAiWCPEARS
OrthoDBiEOG091G03R1
PhylomeDBiQ9BU19
TreeFamiTF332664

Enzyme and pathway databases

ReactomeiR-HSA-212436 Generic Transcription Pathway
SIGNORiQ9BU19

Miscellaneous databases

ChiTaRSiZNF692 human
EvolutionaryTraceiQ9BU19
GenomeRNAii55657
PROiPR:Q9BU19
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000171163 Expressed in 218 organ(s), highest expression level in right hemisphere of cerebellum
CleanExiHS_ZNF692
ExpressionAtlasiQ9BU19 baseline and differential
GenevisibleiQ9BU19 HS

Family and domain databases

InterProiView protein in InterPro
IPR036236 Znf_C2H2_sf
IPR013087 Znf_C2H2_type
PfamiView protein in Pfam
PF00096 zf-C2H2, 4 hits
SMARTiView protein in SMART
SM00355 ZnF_C2H2, 5 hits
SUPFAMiSSF57667 SSF57667, 3 hits
PROSITEiView protein in PROSITE
PS00028 ZINC_FINGER_C2H2_1, 5 hits
PS50157 ZINC_FINGER_C2H2_2, 5 hits
ProtoNetiSearch...

Entry informationi

Entry nameiZN692_HUMAN
AccessioniPrimary (citable) accession number: Q9BU19
Secondary accession number(s): B4DXZ0
, Q5SRA5, Q5SRA6, Q9HBC9, Q9NW93, Q9NWY6, Q9UF97
Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 2, 2006
Last sequence update: June 1, 2001
Last modified: November 7, 2018
This is version 148 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  6. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again