Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 159 (22 Apr 2020)
Sequence version 1 (01 Jun 2001)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Zinc finger protein 692

Gene

ZNF692

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

May be involved in transcriptional regulation.

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section specifies the position(s) and type(s) of zinc fingers within the protein.<p><a href='/help/zn_fing' target='_top'>More...</a></p>Zinc fingeri328 – 353C2H2-type 1PROSITE-ProRule annotationAdd BLAST26
Zinc fingeri359 – 383C2H2-type 2PROSITE-ProRule annotationAdd BLAST25
Zinc fingeri389 – 411C2H2-type 3PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri417 – 439C2H2-type 4PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri448 – 471C2H2-type 5PROSITE-ProRule annotationAdd BLAST24

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionDNA-binding
Biological processTranscription, Transcription regulation
LigandMetal-binding, Zinc

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-212436 Generic Transcription Pathway

SIGNOR Signaling Network Open Resource

More...
SIGNORi
Q9BU19

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Zinc finger protein 692
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:ZNF692
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 1

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:26049 ZNF692

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
617758 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q9BU19

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

Open Targets

More...
OpenTargetsi
ENSG00000171163

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA142670491

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q9BU19 Tdark

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
ZNF692

Domain mapping of disease mutations (DMDM)

More...
DMDMi
74761262

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002340141 – 519Zinc finger protein 692Add BLAST519

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei162PhosphoserineCombined sources1
Modified residuei231PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q9BU19

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q9BU19

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q9BU19

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9BU19

PeptideAtlas

More...
PeptideAtlasi
Q9BU19

PRoteomics IDEntifications database

More...
PRIDEi
Q9BU19

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
79040 [Q9BU19-1]
79041 [Q9BU19-2]
79042 [Q9BU19-3]
79043 [Q9BU19-4]
79044 [Q9BU19-5]

Consortium for Top Down Proteomics

More...
TopDownProteomicsi
Q9BU19-3 [Q9BU19-3]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9BU19

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9BU19

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000171163 Expressed in right hemisphere of cerebellum and 217 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q9BU19 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9BU19 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
ENSG00000171163 Low tissue specificity

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
120789, 38 interactors

Protein interaction database and analysis system

More...
IntActi
Q9BU19, 29 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000391200

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q9BU19 protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1519
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q9BU19

Database of comparative protein structure models

More...
ModBasei
Search...

Protein Data Bank in Europe - Knowledge Base

More...
PDBe-KBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
Q9BU19

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri328 – 353C2H2-type 1PROSITE-ProRule annotationAdd BLAST26
Zinc fingeri359 – 383C2H2-type 2PROSITE-ProRule annotationAdd BLAST25
Zinc fingeri389 – 411C2H2-type 3PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri417 – 439C2H2-type 4PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri448 – 471C2H2-type 5PROSITE-ProRule annotationAdd BLAST24

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG1721 Eukaryota
COG5048 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000161175

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_045687_1_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9BU19

Identification of Orthologs from Complete Genome Data

More...
OMAi
CHAHSRE

Database of Orthologous Groups

More...
OrthoDBi
1318335at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9BU19

TreeFam database of animal gene trees

More...
TreeFami
TF332664

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR036236 Znf_C2H2_sf
IPR013087 Znf_C2H2_type

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00096 zf-C2H2, 3 hits

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00355 ZnF_C2H2, 5 hits

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF57667 SSF57667, 3 hits

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00028 ZINC_FINGER_C2H2_1, 5 hits
PS50157 ZINC_FINGER_C2H2_2, 5 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (5+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 5 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 5 described isoforms and 7 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9BU19-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MASSPAVDVS CRRREKRRQL DARRSKCRIR LGGHMEQWCL LKERLGFSLH
60 70 80 90 100
SQLAKFLLDR YTSSGCVLCA GPEPLPPKGL QYLVLLSHAH SRECSLVPGL
110 120 130 140 150
RGPGGQDGGL VWECSAGHTF SWGPSLSPTP SEAPKPASLP HTTRRSWCSE
160 170 180 190 200
ATSGQELADL ESEHDERTQE ARLPRRVGPP PETFPPPGEE EGEEEEDNDE
210 220 230 240 250
DEEEMLSDAS LWTYSSSPDD SEPDAPRLLP SPVTCTPKEG ETPPAPAALS
260 270 280 290 300
SPLAVPALSA SSLSSRAPPP AEVRVQPQLS RTPQAAQQTE ALASTGSQAQ
310 320 330 340 350
SAPTPAWDED TAQIGPKRIR KAAKRELMPC DFPGCGRIFS NRQYLNHHKK
360 370 380 390 400
YQHIHQKSFS CPEPACGKSF NFKKHLKEHM KLHSDTRDYI CEFCARSFRT
410 420 430 440 450
SSNLVIHRRI HTGEKPLQCE ICGFTCRQKA SLNWHQRKHA ETVAALRFPC
460 470 480 490 500
EFCGKRFEKP DSVAAHRSKS HPALLLAPQE SPSGPLEPCP SISAPGPLGS
510
SEGSRPSASP QAPTLLPQQ
Length:519
Mass (Da):56,968
Last modified:June 1, 2001 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iDEFAEF73C910619E
GO
Isoform 2 (identifier: Q9BU19-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     175-220: RRVGPPPETFPPPGEEEGEEEEDNDEDEEEMLSDASLWTYSSSPDD → S

Show »
Length:474
Mass (Da):51,876
Checksum:iD550C5B21F03C12F
GO
Isoform 3 (identifier: Q9BU19-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     88-259: Missing.

Show »
Length:347
Mass (Da):38,643
Checksum:i8C92016FCA82AAE3
GO
Isoform 4 (identifier: Q9BU19-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     61-96: YTSSGCVLCAGPEPLPPKGLQYLVLLSHAHSRECSL → ACPAALFHPQVSHFTRTACVTCGLRGSCSPPHGLSE
     97-519: Missing.

Show »
Length:96
Mass (Da):10,819
Checksum:i6D555AC70BA6CF00
GO
Isoform 5 (identifier: Q9BU19-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MPLVHM

Show »
Length:524
Mass (Da):57,546
Checksum:i5A64D0C5F805388F
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 7 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H0YCH4H0YCH4_HUMAN
Zinc finger protein 692
ZNF692
273Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YEY1H0YEY1_HUMAN
Zinc finger protein 692
ZNF692
164Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YDF5H0YDF5_HUMAN
Zinc finger protein 692
ZNF692
79Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9PRH5E9PRH5_HUMAN
Zinc finger protein 692
ZNF692
132Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E7ET73E7ET73_HUMAN
Zinc finger protein 692
ZNF692
105Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9PLQ7E9PLQ7_HUMAN
Zinc finger protein 692
ZNF692
69Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9PLQ5E9PLQ5_HUMAN
Zinc finger protein 692
ZNF692
80Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti373K → R in BAA91490 (PubMed:14702039).Curated1
Sequence conflicti401S → G in BAA91239 (PubMed:14702039).Curated1
Sequence conflicti435H → R in BAA91490 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_033590230P → R1 PublicationCorresponds to variant dbSNP:rs13313088Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0430251M → MPLVHM in isoform 5. 1 Publication1
Alternative sequenceiVSP_01818561 – 96YTSSG…RECSL → ACPAALFHPQVSHFTRTACV TCGLRGSCSPPHGLSE in isoform 4. 1 PublicationAdd BLAST36
Alternative sequenceiVSP_01818688 – 259Missing in isoform 3. 1 PublicationAdd BLAST172
Alternative sequenceiVSP_01818797 – 519Missing in isoform 4. 1 PublicationAdd BLAST423
Alternative sequenceiVSP_018188175 – 220RRVGP…SSPDD → S in isoform 2. 1 PublicationAdd BLAST46

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AK000538 mRNA Translation: BAA91239.1
AK001070 mRNA Translation: BAA91490.1
AK302187 mRNA Translation: BAG63552.1
AL133100 mRNA Translation: CAB61410.2
AL672291 Genomic DNA No translation available.
BC002948 mRNA Translation: AAH02948.1
AF256175 Transcribed RNA Translation: AAG15327.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS31127.1 [Q9BU19-1]
CCDS44348.1 [Q9BU19-5]
CCDS53487.1 [Q9BU19-2]

Protein sequence database of the Protein Information Resource

More...
PIRi
T42682

NCBI Reference Sequences

More...
RefSeqi
NP_001129508.1, NM_001136036.2 [Q9BU19-5]
NP_001180257.1, NM_001193328.1 [Q9BU19-2]
NP_060335.2, NM_017865.3 [Q9BU19-1]
XP_011542524.1, XM_011544222.1 [Q9BU19-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000306601; ENSP00000305483; ENSG00000171163 [Q9BU19-1]
ENST00000366471; ENSP00000355427; ENSG00000171163 [Q9BU19-2]
ENST00000451251; ENSP00000391200; ENSG00000171163 [Q9BU19-5]
ENST00000463519; ENSP00000436308; ENSG00000171163 [Q9BU19-4]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
55657

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:55657

UCSC genome browser

More...
UCSCi
uc001ifc.3 human [Q9BU19-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK000538 mRNA Translation: BAA91239.1
AK001070 mRNA Translation: BAA91490.1
AK302187 mRNA Translation: BAG63552.1
AL133100 mRNA Translation: CAB61410.2
AL672291 Genomic DNA No translation available.
BC002948 mRNA Translation: AAH02948.1
AF256175 Transcribed RNA Translation: AAG15327.1
CCDSiCCDS31127.1 [Q9BU19-1]
CCDS44348.1 [Q9BU19-5]
CCDS53487.1 [Q9BU19-2]
PIRiT42682
RefSeqiNP_001129508.1, NM_001136036.2 [Q9BU19-5]
NP_001180257.1, NM_001193328.1 [Q9BU19-2]
NP_060335.2, NM_017865.3 [Q9BU19-1]
XP_011542524.1, XM_011544222.1 [Q9BU19-1]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2D9HNMR-A417-481[»]
2DLKNMR-A328-393[»]
6H0GX-ray4.25C/F416-441[»]
SMRiQ9BU19
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGridi120789, 38 interactors
IntActiQ9BU19, 29 interactors
STRINGi9606.ENSP00000391200

PTM databases

iPTMnetiQ9BU19
PhosphoSitePlusiQ9BU19

Polymorphism and mutation databases

BioMutaiZNF692
DMDMi74761262

Proteomic databases

jPOSTiQ9BU19
MassIVEiQ9BU19
MaxQBiQ9BU19
PaxDbiQ9BU19
PeptideAtlasiQ9BU19
PRIDEiQ9BU19
ProteomicsDBi79040 [Q9BU19-1]
79041 [Q9BU19-2]
79042 [Q9BU19-3]
79043 [Q9BU19-4]
79044 [Q9BU19-5]
TopDownProteomicsiQ9BU19-3 [Q9BU19-3]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
54395 38 antibodies

Genome annotation databases

EnsembliENST00000306601; ENSP00000305483; ENSG00000171163 [Q9BU19-1]
ENST00000366471; ENSP00000355427; ENSG00000171163 [Q9BU19-2]
ENST00000451251; ENSP00000391200; ENSG00000171163 [Q9BU19-5]
ENST00000463519; ENSP00000436308; ENSG00000171163 [Q9BU19-4]
GeneIDi55657
KEGGihsa:55657
UCSCiuc001ifc.3 human [Q9BU19-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
55657

GeneCards: human genes, protein and diseases

More...
GeneCardsi
ZNF692
HGNCiHGNC:26049 ZNF692
HPAiENSG00000171163 Low tissue specificity
MIMi617758 gene
neXtProtiNX_Q9BU19
OpenTargetsiENSG00000171163
PharmGKBiPA142670491

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG1721 Eukaryota
COG5048 LUCA
GeneTreeiENSGT00940000161175
HOGENOMiCLU_045687_1_0_1
InParanoidiQ9BU19
OMAiCHAHSRE
OrthoDBi1318335at2759
PhylomeDBiQ9BU19
TreeFamiTF332664

Enzyme and pathway databases

ReactomeiR-HSA-212436 Generic Transcription Pathway
SIGNORiQ9BU19

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
ZNF692 human
EvolutionaryTraceiQ9BU19

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
55657
PharosiQ9BU19 Tdark

Protein Ontology

More...
PROi
PR:Q9BU19
RNActiQ9BU19 protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000171163 Expressed in right hemisphere of cerebellum and 217 other tissues
ExpressionAtlasiQ9BU19 baseline and differential
GenevisibleiQ9BU19 HS

Family and domain databases

InterProiView protein in InterPro
IPR036236 Znf_C2H2_sf
IPR013087 Znf_C2H2_type
PfamiView protein in Pfam
PF00096 zf-C2H2, 3 hits
SMARTiView protein in SMART
SM00355 ZnF_C2H2, 5 hits
SUPFAMiSSF57667 SSF57667, 3 hits
PROSITEiView protein in PROSITE
PS00028 ZINC_FINGER_C2H2_1, 5 hits
PS50157 ZINC_FINGER_C2H2_2, 5 hits

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiZN692_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9BU19
Secondary accession number(s): B4DXZ0
, Q5SRA5, Q5SRA6, Q9HBC9, Q9NW93, Q9NWY6, Q9UF97
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 2, 2006
Last sequence update: June 1, 2001
Last modified: April 22, 2020
This is version 159 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. SIMILARITY comments
    Index of protein domains and families
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  6. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again