Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 144 (16 Oct 2019)
Sequence version 2 (16 May 2006)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Nucleoporin NDC1

Gene

NDC1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Component of the nuclear pore complex (NPC), which plays a key role in de novo assembly and insertion of NPC in the nuclear envelope. Required for NPC and nuclear envelope assembly, possibly by forming a link between the nuclear envelope membrane and soluble nucleoporins, thereby anchoring the NPC in the membrane.2 Publications

Miscellaneous

Depletion of NDC1 from HeLa cells interferes with the assembly of phenylalanine-glycine (FG) repeat Nups into nuclear pore complexes.

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processmRNA transport, Protein transport, Translocation, Transport

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-1169408 ISG15 antiviral mechanism
R-HSA-159227 Transport of the SLBP independent Mature mRNA
R-HSA-159230 Transport of the SLBP Dependant Mature mRNA
R-HSA-159231 Transport of Mature mRNA Derived from an Intronless Transcript
R-HSA-159236 Transport of Mature mRNA derived from an Intron-Containing Transcript
R-HSA-165054 Rev-mediated nuclear export of HIV RNA
R-HSA-168271 Transport of Ribonucleoproteins into the Host Nucleus
R-HSA-168276 NS1 Mediated Effects on Host Pathways
R-HSA-168325 Viral Messenger RNA Synthesis
R-HSA-168333 NEP/NS2 Interacts with the Cellular Export Machinery
R-HSA-170822 Regulation of Glucokinase by Glucokinase Regulatory Protein
R-HSA-180746 Nuclear import of Rev protein
R-HSA-180910 Vpr-mediated nuclear import of PICs
R-HSA-191859 snRNP Assembly
R-HSA-3108214 SUMOylation of DNA damage response and repair proteins
R-HSA-3232142 SUMOylation of ubiquitinylation proteins
R-HSA-3301854 Nuclear Pore Complex (NPC) Disassembly
R-HSA-3371453 Regulation of HSF1-mediated heat shock response
R-HSA-4085377 SUMOylation of SUMOylation proteins
R-HSA-4551638 SUMOylation of chromatin organization proteins
R-HSA-4570464 SUMOylation of RNA binding proteins
R-HSA-4615885 SUMOylation of DNA replication proteins
R-HSA-5578749 Transcriptional regulation by small RNAs
R-HSA-5619107 Defective TPR may confer susceptibility towards thyroid papillary carcinoma (TPC)
R-HSA-6784531 tRNA processing in the nucleus

Protein family/group databases

Transport Classification Database

More...
TCDBi
1.I.1.1.3 the eukaryotic nuclear pore complex (e-npc) family

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Nucleoporin NDC1
Short name:
hNDC1
Alternative name(s):
Transmembrane protein 48
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:NDC1
Synonyms:TMEM48
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 1

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:25525 NDC1

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
610115 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q9BTX1

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini1 – 24CytoplasmicSequence analysisAdd BLAST24
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei25 – 45Helical; Name=1Sequence analysisAdd BLAST21
Topological domaini46 – 68Perinuclear spaceSequence analysisAdd BLAST23
Transmembranei69 – 89Helical; Name=2Sequence analysisAdd BLAST21
Topological domaini90 – 114CytoplasmicSequence analysisAdd BLAST25
Transmembranei115 – 135Helical; Name=3Sequence analysisAdd BLAST21
Topological domaini136 – 165Perinuclear spaceSequence analysisAdd BLAST30
Transmembranei166 – 186Helical; Name=4Sequence analysisAdd BLAST21
Topological domaini187 – 225CytoplasmicSequence analysisAdd BLAST39
Transmembranei226 – 246Helical; Name=5Sequence analysisAdd BLAST21
Topological domaini247 – 272Perinuclear spaceSequence analysisAdd BLAST26
Transmembranei273 – 293Helical; Name=6Sequence analysisAdd BLAST21
Topological domaini294 – 674CytoplasmicSequence analysisAdd BLAST381

Keywords - Cellular componenti

Membrane, Nuclear pore complex, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
55706

Open Targets

More...
OpenTargetsi
ENSG00000058804

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA142670764

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q9BTX1

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
NDC1

Domain mapping of disease mutations (DMDM)

More...
DMDMi
97180263

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002352401 – 674Nucleoporin NDC1Add BLAST674

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei406PhosphoserineCombined sources1
Modified residuei414PhosphothreonineCombined sources1
Modified residuei439PhosphoserineCombined sources1
Modified residuei440PhosphothreonineCombined sources1
Modified residuei445PhosphoserineCombined sources1
Modified residuei449PhosphothreonineCombined sources1
Modified residuei471PhosphoserineCombined sources1
Modified residuei474PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q9BTX1

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q9BTX1

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q9BTX1

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q9BTX1

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9BTX1

PeptideAtlas

More...
PeptideAtlasi
Q9BTX1

PRoteomics IDEntifications database

More...
PRIDEi
Q9BTX1

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
33675
79021 [Q9BTX1-1]
79022 [Q9BTX1-2]
79023 [Q9BTX1-3]
79024 [Q9BTX1-4]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9BTX1

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9BTX1

SwissPalm database of S-palmitoylation events

More...
SwissPalmi
Q9BTX1

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000058804 Expressed in 215 organ(s), highest expression level in female gonad

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9BTX1 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA069751
HPA070882

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with the NUP35/NUP53 (By similarity).

Interacts with AAAS, anchoring it to the nuclear envelope.

By similarity1 Publication

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
120831, 58 interactors

ComplexPortal: manually curated resource of macromolecular complexes

More...
ComplexPortali
CPX-873 Nuclear pore complex

Protein interaction database and analysis system

More...
IntActi
Q9BTX1, 45 interactors

Molecular INTeraction database

More...
MINTi
Q9BTX1

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000360483

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the NDC1 family.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG4358 Eukaryota
ENOG4110XEC LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000014590

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000231135

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9BTX1

KEGG Orthology (KO)

More...
KOi
K14315

Identification of Orthologs from Complete Genome Data

More...
OMAi
YVVQCLA

Database of Orthologous Groups

More...
OrthoDBi
556184at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9BTX1

TreeFam database of animal gene trees

More...
TreeFami
TF324843

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR019049 Nucleoporin_prot_Ndc1/Nup

The PANTHER Classification System

More...
PANTHERi
PTHR13269 PTHR13269, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF09531 Ndc1_Nup, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (6)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 6 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: Q9BTX1-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MATAVSRPCA GRSRDILWRV LGWRIVASIV WSVLFLPICT TVFIIFSRID
60 70 80 90 100
LFHPIQWLSD SFSDLYSSYV IFYFLLLSVV IIIISIFNVE FYAVVPSIPC
110 120 130 140 150
SRLALIGKII HPQQLMHSFI HAAMGMVMAW CAAVITQGQY SFLVVPCTGT
160 170 180 190 200
NSFGSPAAQT CLNEYHLFFL LTGAFMGYSY SLLYFVNNMN YLPFPIIQQY
210 220 230 240 250
KFLRFRRSLL LLVKHSCVES LFLVRNFCIL YYFLGYIPKA WISTAMNLHI
260 270 280 290 300
DEQVHRPLDT VSGLLNLSLL YHVWLCGVFL LTTWYVSWIL FKIYATEAHV
310 320 330 340 350
FPVQPPFAEG SDECLPKVLN SNPPPIIKYL ALQDLMLLSQ YSPSRRQEVF
360 370 380 390 400
SLSQPGGHPH NWTAISRECL NLLNGMTQKL ILYQEAAATN GRVSSSYPVE
410 420 430 440 450
PKKLNSPEET AFQTPKSSQM PRPSVPPLVK TSLFSSKLST PDVVSPFGTP
460 470 480 490 500
FGSSVMNRMA GIFDVNTCYG SPQSPQLIRR GPRLWTSASD QQMTEFSNPS
510 520 530 540 550
PSTSISAEGK TMRQPSVIYS WIQNKREQIK NFLSKRVLIM YFFSKHPEAS
560 570 580 590 600
IQAVFSDAQM HIWALEGLSH LVAASFTEDR FGVVQTTLPA ILNTLLTLQE
610 620 630 640 650
AVDKYFKLPH ASSKPPRISG SLVDTSYKTL RFAFRASLKT AIYRITTTFG
660 670
EHLNAVQASA EHQKRLQQFL EFKE
Length:674
Mass (Da):76,305
Last modified:May 16, 2006 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i78368FEB232895D9
GO
Isoform 2 (identifier: Q9BTX1-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     93-93: Missing.

Note: No experimental confirmation available.
Show »
Length:673
Mass (Da):76,234
Checksum:i27A688260C1B2852
GO
Isoform 3 (identifier: Q9BTX1-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     376-492: Missing.

Note: No experimental confirmation available.
Show »
Length:557
Mass (Da):63,572
Checksum:iC9AC3DCCCF3D5EBE
GO
Isoform 4 (identifier: Q9BTX1-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     509-542: GKTMRQPSVIYSWIQNKREQIKNFLSKRVLIMYF → APRGLHSGCFFRCPNAYLGIRRSVALSSSIIYRG
     543-674: Missing.

Note: No experimental confirmation available.
Show »
Length:542
Mass (Da):61,009
Checksum:i06630F6E487BAC55
GO
Isoform 5 (identifier: Q9BTX1-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     95-135: VPSIPCSRLALIGKIIHPQQLMHSFIHAAMGMVMAWCAAVI → I

Note: No experimental confirmation available.
Show »
Length:634
Mass (Da):71,992
Checksum:iF80C5BBAFEF9C41F
GO
Isoform 6 (identifier: Q9BTX1-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-115: Missing.

Note: No experimental confirmation available.
Show »
Length:559
Mass (Da):63,158
Checksum:iB2DD7D9EE6AF56EA
GO

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAB14135 differs from that shown. Reason: Erroneous initiation.Curated
The sequence BAC03665 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti261V → A in BAG58064 (PubMed:14702039).Curated1
Sequence conflicti476Q → R in BAG58064 (PubMed:14702039).Curated1
Sequence conflicti525K → R in BAG61017 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_026388154G → D2 PublicationsCorresponds to variant dbSNP:rs17849721Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0553311 – 115Missing in isoform 6. 1 PublicationAdd BLAST115
Alternative sequenceiVSP_01839693Missing in isoform 2. 1 Publication1
Alternative sequenceiVSP_05533295 – 135VPSIP…CAAVI → I in isoform 5. 1 PublicationAdd BLAST41
Alternative sequenceiVSP_018397376 – 492Missing in isoform 3. 1 PublicationAdd BLAST117
Alternative sequenceiVSP_018398509 – 542GKTMR…LIMYF → APRGLHSGCFFRCPNAYLGI RRSVALSSSIIYRG in isoform 4. CuratedAdd BLAST34
Alternative sequenceiVSP_018399543 – 674Missing in isoform 4. CuratedAdd BLAST132

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
DQ141696 mRNA Translation: AAZ73087.1
AK001269 mRNA Translation: BAA91592.1
AK022618 mRNA Translation: BAB14135.1 Different initiation.
AK091439 mRNA Translation: BAC03665.1 Different initiation.
AK298909 mRNA Translation: BAG61017.1
AK295000 mRNA Translation: BAG58064.1
AL354612 mRNA Translation: CAB89725.1
AL354613 mRNA Translation: CAB89726.1
AL049745 Genomic DNA No translation available.
CH471059 Genomic DNA Translation: EAX06731.1
BC003082 mRNA Translation: AAH03082.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS583.1 [Q9BTX1-1]

NCBI Reference Sequences

More...
RefSeqi
NP_001162023.1, NM_001168551.1 [Q9BTX1-5]
NP_060557.3, NM_018087.4 [Q9BTX1-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000371429; ENSP00000360483; ENSG00000058804 [Q9BTX1-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
55706

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:55706

UCSC genome browser

More...
UCSCi
uc001cvs.4 human [Q9BTX1-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
DQ141696 mRNA Translation: AAZ73087.1
AK001269 mRNA Translation: BAA91592.1
AK022618 mRNA Translation: BAB14135.1 Different initiation.
AK091439 mRNA Translation: BAC03665.1 Different initiation.
AK298909 mRNA Translation: BAG61017.1
AK295000 mRNA Translation: BAG58064.1
AL354612 mRNA Translation: CAB89725.1
AL354613 mRNA Translation: CAB89726.1
AL049745 Genomic DNA No translation available.
CH471059 Genomic DNA Translation: EAX06731.1
BC003082 mRNA Translation: AAH03082.1
CCDSiCCDS583.1 [Q9BTX1-1]
RefSeqiNP_001162023.1, NM_001168551.1 [Q9BTX1-5]
NP_060557.3, NM_018087.4 [Q9BTX1-1]

3D structure databases

Database of comparative protein structure models

More...
ModBasei
Search...

SWISS-MODEL Interactive Workspace

More...
SWISS-MODEL-Workspacei
Submit a new modelling project...

Protein-protein interaction databases

BioGridi120831, 58 interactors
ComplexPortaliCPX-873 Nuclear pore complex
IntActiQ9BTX1, 45 interactors
MINTiQ9BTX1
STRINGi9606.ENSP00000360483

Protein family/group databases

TCDBi1.I.1.1.3 the eukaryotic nuclear pore complex (e-npc) family

PTM databases

iPTMnetiQ9BTX1
PhosphoSitePlusiQ9BTX1
SwissPalmiQ9BTX1

Polymorphism and mutation databases

BioMutaiNDC1
DMDMi97180263

Proteomic databases

EPDiQ9BTX1
jPOSTiQ9BTX1
MassIVEiQ9BTX1
MaxQBiQ9BTX1
PaxDbiQ9BTX1
PeptideAtlasiQ9BTX1
PRIDEiQ9BTX1
ProteomicsDBi33675
79021 [Q9BTX1-1]
79022 [Q9BTX1-2]
79023 [Q9BTX1-3]
79024 [Q9BTX1-4]

Genome annotation databases

EnsembliENST00000371429; ENSP00000360483; ENSG00000058804 [Q9BTX1-1]
GeneIDi55706
KEGGihsa:55706
UCSCiuc001cvs.4 human [Q9BTX1-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
55706
DisGeNETi55706

GeneCards: human genes, protein and diseases

More...
GeneCardsi
NDC1
HGNCiHGNC:25525 NDC1
HPAiHPA069751
HPA070882
MIMi610115 gene
neXtProtiNX_Q9BTX1
OpenTargetsiENSG00000058804
PharmGKBiPA142670764

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG4358 Eukaryota
ENOG4110XEC LUCA
GeneTreeiENSGT00390000014590
HOGENOMiHOG000231135
InParanoidiQ9BTX1
KOiK14315
OMAiYVVQCLA
OrthoDBi556184at2759
PhylomeDBiQ9BTX1
TreeFamiTF324843

Enzyme and pathway databases

ReactomeiR-HSA-1169408 ISG15 antiviral mechanism
R-HSA-159227 Transport of the SLBP independent Mature mRNA
R-HSA-159230 Transport of the SLBP Dependant Mature mRNA
R-HSA-159231 Transport of Mature mRNA Derived from an Intronless Transcript
R-HSA-159236 Transport of Mature mRNA derived from an Intron-Containing Transcript
R-HSA-165054 Rev-mediated nuclear export of HIV RNA
R-HSA-168271 Transport of Ribonucleoproteins into the Host Nucleus
R-HSA-168276 NS1 Mediated Effects on Host Pathways
R-HSA-168325 Viral Messenger RNA Synthesis
R-HSA-168333 NEP/NS2 Interacts with the Cellular Export Machinery
R-HSA-170822 Regulation of Glucokinase by Glucokinase Regulatory Protein
R-HSA-180746 Nuclear import of Rev protein
R-HSA-180910 Vpr-mediated nuclear import of PICs
R-HSA-191859 snRNP Assembly
R-HSA-3108214 SUMOylation of DNA damage response and repair proteins
R-HSA-3232142 SUMOylation of ubiquitinylation proteins
R-HSA-3301854 Nuclear Pore Complex (NPC) Disassembly
R-HSA-3371453 Regulation of HSF1-mediated heat shock response
R-HSA-4085377 SUMOylation of SUMOylation proteins
R-HSA-4551638 SUMOylation of chromatin organization proteins
R-HSA-4570464 SUMOylation of RNA binding proteins
R-HSA-4615885 SUMOylation of DNA replication proteins
R-HSA-5578749 Transcriptional regulation by small RNAs
R-HSA-5619107 Defective TPR may confer susceptibility towards thyroid papillary carcinoma (TPC)
R-HSA-6784531 tRNA processing in the nucleus

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
NDC1 human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
TMEM48

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
55706
PharosiQ9BTX1

Protein Ontology

More...
PROi
PR:Q9BTX1

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000058804 Expressed in 215 organ(s), highest expression level in female gonad
GenevisibleiQ9BTX1 HS

Family and domain databases

InterProiView protein in InterPro
IPR019049 Nucleoporin_prot_Ndc1/Nup
PANTHERiPTHR13269 PTHR13269, 1 hit
PfamiView protein in Pfam
PF09531 Ndc1_Nup, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiNDC1_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9BTX1
Secondary accession number(s): B4DHA3
, B4DQQ5, G3XA81, Q8NB76, Q9H9T6, Q9NSG3, Q9NSG4, Q9NVZ7
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 16, 2006
Last sequence update: May 16, 2006
Last modified: October 16, 2019
This is version 144 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  4. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  5. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again