Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Dynactin subunit 5

Gene

DCTN5

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

GO - Biological processi

Enzyme and pathway databases

ReactomeiR-HSA-2132295 MHC class II antigen presentation
R-HSA-3371497 HSP90 chaperone cycle for steroid hormone receptors (SHR)
R-HSA-6807878 COPI-mediated anterograde transport
R-HSA-6811436 COPI-independent Golgi-to-ER retrograde traffic

Names & Taxonomyi

Protein namesi
Recommended name:
Dynactin subunit 5
Alternative name(s):
Dynactin subunit p25
Gene namesi
Name:DCTN5
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 16

Organism-specific databases

EuPathDBiHostDB:ENSG00000166847.9
HGNCiHGNC:24594 DCTN5
MIMi612962 gene
neXtProtiNX_Q9BTE1

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Centromere, Chromosome, Cytoplasm, Cytoskeleton, Kinetochore

Pathology & Biotechi

Organism-specific databases

DisGeNETi84516
OpenTargetsiENSG00000166847
PharmGKBiPA142672007

Polymorphism and mutation databases

BioMutaiDCTN5
DMDMi62900103

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000798271 – 182Dynactin subunit 5Add BLAST182

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei1N-acetylmethionineCombined sources1

Keywords - PTMi

Acetylation

Proteomic databases

EPDiQ9BTE1
MaxQBiQ9BTE1
PaxDbiQ9BTE1
PeptideAtlasiQ9BTE1
PRIDEiQ9BTE1
ProteomicsDBi78981

PTM databases

iPTMnetiQ9BTE1
PhosphoSitePlusiQ9BTE1

Expressioni

Gene expression databases

BgeeiENSG00000166847 Expressed in 220 organ(s), highest expression level in adrenal tissue
CleanExiHS_DCTN5
ExpressionAtlasiQ9BTE1 baseline and differential
GenevisibleiQ9BTE1 HS

Organism-specific databases

HPAiHPA042003
HPA063710

Interactioni

Subunit structurei

Member of the pointed-end complex of the dynactin shoulder complex which contains DCTN4, DCTN5 and DCTN6 subunits and ACTR10. Within the complex DCTN6 forms a heterodimer with DCTN5.1 Publication

Binary interactionsi

Protein-protein interaction databases

BioGridi124110, 39 interactors
IntActiQ9BTE1, 17 interactors
STRINGi9606.ENSP00000300087

Structurei

3D structure databases

ProteinModelPortaliQ9BTE1
SMRiQ9BTE1
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Phylogenomic databases

eggNOGiKOG3121 Eukaryota
ENOG410YENR LUCA
GeneTreeiENSGT00390000015360
HOGENOMiHOG000198229
HOVERGENiHBG051325
InParanoidiQ9BTE1
KOiK10427
OMAiGNFNYYP
OrthoDBiEOG091G0NK3
PhylomeDBiQ9BTE1
TreeFamiTF314194

Family and domain databases

InterProiView protein in InterPro
IPR001451 Hexapep
IPR011004 Trimer_LpxA-like_sf
PfamiView protein in Pfam
PF00132 Hexapep, 1 hit
SUPFAMiSSF51161 SSF51161, 1 hit

Sequences (3+)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 4 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9BTE1-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MELGELLYNK SEYIETASGN KVSRQSVLCG SQNIVLNGKT IVMNDCIIRG
60 70 80 90 100
DLANVRVGRH CVVKSRSVIR PPFKKFSKGV AFFPLHIGDH VFIEEDCVVN
110 120 130 140 150
AAQIGSYVHV GKNCVIGRRC VLKDCCKILD NTVLPPETVV PPFTVFSGCP
160 170 180
GLFSGELPEC TQELMIDVTK SYYQKFLPLT QV
Length:182
Mass (Da):20,127
Last modified:June 1, 2001 - v1
Checksum:i476DBD27A6CA1C35
GO
Isoform 2 (identifier: Q9BTE1-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     151-182: GLFSGELPECTQELMIDVTKSYYQKFLPLTQV → AP

Note: No experimental confirmation available.
Show »
Length:152
Mass (Da):16,633
Checksum:iFFC398F012D63D03
GO
Isoform 3 (identifier: Q9BTE1-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     40-182: TIVMNDCIIR...YQKFLPLTQV → NFVISVFLSP...EWWGLVNWRM

Show »
Length:84
Mass (Da):9,740
Checksum:iB269846E7CD827D3
GO

Computationally mapped potential isoform sequencesi

There are 4 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H3BR94H3BR94_HUMAN
Dynactin subunit 5
DCTN5
155Annotation score:
I3L0U8I3L0U8_HUMAN
Dynactin subunit 5
DCTN5
99Annotation score:
H3BS05H3BS05_HUMAN
Dynactin subunit 5
DCTN5
75Annotation score:
H3BUD2H3BUD2_HUMAN
Dynactin subunit 5
DCTN5
53Annotation score:

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_04669740 – 182TIVMN…PLTQV → NFVISVFLSPYIRCHSACRD RKRSDESVRLSVNNREWWGL VNWRM in isoform 3. CuratedAdd BLAST143
Alternative sequenceiVSP_046023151 – 182GLFSG…PLTQV → AP in isoform 2. 1 PublicationAdd BLAST32

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK027387 mRNA Translation: BAB55077.1
AK292843 mRNA Translation: BAF85532.1
AC008870 Genomic DNA No translation available.
CH471145 Genomic DNA Translation: EAW55809.1
CH471145 Genomic DNA Translation: EAW55810.1
BC004191 mRNA Translation: AAH04191.1
CD388246 mRNA No translation available.
CCDSiCCDS10615.1 [Q9BTE1-1]
CCDS58435.1 [Q9BTE1-3]
CCDS58436.1 [Q9BTE1-2]
RefSeqiNP_001185940.1, NM_001199011.1 [Q9BTE1-3]
NP_001186672.1, NM_001199743.1 [Q9BTE1-2]
NP_115875.1, NM_032486.3 [Q9BTE1-1]
UniGeneiHs.435941

Genome annotation databases

EnsembliENST00000300087; ENSP00000300087; ENSG00000166847 [Q9BTE1-1]
ENST00000563998; ENSP00000454691; ENSG00000166847 [Q9BTE1-2]
ENST00000568272; ENSP00000455685; ENSG00000166847 [Q9BTE1-3]
GeneIDi84516
KEGGihsa:84516
UCSCiuc002dly.3 human [Q9BTE1-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK027387 mRNA Translation: BAB55077.1
AK292843 mRNA Translation: BAF85532.1
AC008870 Genomic DNA No translation available.
CH471145 Genomic DNA Translation: EAW55809.1
CH471145 Genomic DNA Translation: EAW55810.1
BC004191 mRNA Translation: AAH04191.1
CD388246 mRNA No translation available.
CCDSiCCDS10615.1 [Q9BTE1-1]
CCDS58435.1 [Q9BTE1-3]
CCDS58436.1 [Q9BTE1-2]
RefSeqiNP_001185940.1, NM_001199011.1 [Q9BTE1-3]
NP_001186672.1, NM_001199743.1 [Q9BTE1-2]
NP_115875.1, NM_032486.3 [Q9BTE1-1]
UniGeneiHs.435941

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
5NW4electron microscopy8.70h1-182[»]
ProteinModelPortaliQ9BTE1
SMRiQ9BTE1
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi124110, 39 interactors
IntActiQ9BTE1, 17 interactors
STRINGi9606.ENSP00000300087

PTM databases

iPTMnetiQ9BTE1
PhosphoSitePlusiQ9BTE1

Polymorphism and mutation databases

BioMutaiDCTN5
DMDMi62900103

Proteomic databases

EPDiQ9BTE1
MaxQBiQ9BTE1
PaxDbiQ9BTE1
PeptideAtlasiQ9BTE1
PRIDEiQ9BTE1
ProteomicsDBi78981

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000300087; ENSP00000300087; ENSG00000166847 [Q9BTE1-1]
ENST00000563998; ENSP00000454691; ENSG00000166847 [Q9BTE1-2]
ENST00000568272; ENSP00000455685; ENSG00000166847 [Q9BTE1-3]
GeneIDi84516
KEGGihsa:84516
UCSCiuc002dly.3 human [Q9BTE1-1]

Organism-specific databases

CTDi84516
DisGeNETi84516
EuPathDBiHostDB:ENSG00000166847.9
GeneCardsiDCTN5
H-InvDBiHIX0134374
HGNCiHGNC:24594 DCTN5
HPAiHPA042003
HPA063710
MIMi612962 gene
neXtProtiNX_Q9BTE1
OpenTargetsiENSG00000166847
PharmGKBiPA142672007
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG3121 Eukaryota
ENOG410YENR LUCA
GeneTreeiENSGT00390000015360
HOGENOMiHOG000198229
HOVERGENiHBG051325
InParanoidiQ9BTE1
KOiK10427
OMAiGNFNYYP
OrthoDBiEOG091G0NK3
PhylomeDBiQ9BTE1
TreeFamiTF314194

Enzyme and pathway databases

ReactomeiR-HSA-2132295 MHC class II antigen presentation
R-HSA-3371497 HSP90 chaperone cycle for steroid hormone receptors (SHR)
R-HSA-6807878 COPI-mediated anterograde transport
R-HSA-6811436 COPI-independent Golgi-to-ER retrograde traffic

Miscellaneous databases

ChiTaRSiDCTN5 human
GeneWikiiDCTN5
GenomeRNAii84516
PROiPR:Q9BTE1
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000166847 Expressed in 220 organ(s), highest expression level in adrenal tissue
CleanExiHS_DCTN5
ExpressionAtlasiQ9BTE1 baseline and differential
GenevisibleiQ9BTE1 HS

Family and domain databases

InterProiView protein in InterPro
IPR001451 Hexapep
IPR011004 Trimer_LpxA-like_sf
PfamiView protein in Pfam
PF00132 Hexapep, 1 hit
SUPFAMiSSF51161 SSF51161, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiDCTN5_HUMAN
AccessioniPrimary (citable) accession number: Q9BTE1
Secondary accession number(s): A8K9X8, H3BN51, H3BQA4
Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 26, 2005
Last sequence update: June 1, 2001
Last modified: November 7, 2018
This is version 134 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 16
    Human chromosome 16: entries, gene names and cross-references to MIM
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  4. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again