Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 194 (29 Sep 2021)
Sequence version 5 (17 Oct 2006)
Previous versions | rss
Add a publicationFeedback
Protein

Death-inducer obliterator 1

Gene

DIDO1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Putative transcription factor, weakly pro-apoptotic when overexpressed (By similarity).

Tumor suppressor. Required for early embryonic stem cell development.

By similarity1 Publication

Displaces isoform 4 at the onset of differentiation, required for repression of stemness genes.

1 Publication

Miscellaneous

Defects in DIDO1 may be a cause of myeloid neoplasms.

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section specifies the position(s) and type(s) of zinc fingers within the protein.<p><a href='/help/zn_fing' target='_top'>More...</a></p>Zinc fingeri268 – 322PHD-typePROSITE-ProRule annotationAdd BLAST55

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processApoptosis
LigandMetal-binding, Zinc

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...
PathwayCommonsi
Q9BTC0

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-1221632, Meiotic synapsis [Q9BTC0-1]

SIGNOR Signaling Network Open Resource

More...
SIGNORi
Q9BTC0

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Death-inducer obliterator 1
Short name:
DIO-1
Short name:
hDido1
Alternative name(s):
Death-associated transcription factor 1
Short name:
DATF-1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:DIDO1
Synonyms:C20orf158, DATF1, KIAA0333
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 20

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:2680, DIDO1

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
604140, gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q9BTC0

Eukaryotic Pathogen, Vector and Host Database Resources

More...
VEuPathDBi
HostDB:ENSG00000101191

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Keywords - Cellular componenti

Cytoplasm, Cytoskeleton, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi291W → T: Abolishes binding to H3K4me3. 1 Publication1

Organism-specific databases

DisGeNET

More...
DisGeNETi
11083

Open Targets

More...
OpenTargetsi
ENSG00000101191

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA27147

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q9BTC0, Tbio

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
DIDO1

Domain mapping of disease mutations (DMDM)

More...
DMDMi
116241332

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000593241 – 2240Death-inducer obliterator 1Add BLAST2240

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei1N-acetylmethionineCombined sources1 Publication1
Modified residuei60PhosphoserineCombined sources1
Modified residuei114PhosphoserineBy similarity1
Modified residuei151PhosphothreonineCombined sources1
Modified residuei152PhosphoserineCombined sources1
Modified residuei154PhosphoserineCombined sources1
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section describes <strong>covalent linkages</strong> of various types formed <strong>between two proteins (interchain cross-links)</strong> or <strong>between two parts of the same protein (intrachain cross-links)</strong>, except the disulfide bonds that are annotated in the <a href="http://www.uniprot.org/manual/disulfid">'Disulfide bond'</a> subsection.<p><a href='/help/crosslnk' target='_top'>More...</a></p>Cross-linki247Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Modified residuei523PhosphoserineCombined sources1
Modified residuei805PhosphoserineCombined sources1
Modified residuei809PhosphoserineCombined sources1
Cross-linki879Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Modified residuei889PhosphoserineBy similarity1
Modified residuei898PhosphoserineCombined sources1
Modified residuei1019PhosphoserineCombined sources1
Modified residuei1030PhosphoserineCombined sources1
Modified residuei1040PhosphoserineCombined sources1
Modified residuei1244PhosphotyrosineCombined sources1
Modified residuei1256PhosphothreonineBy similarity1
Modified residuei1260PhosphoserineCombined sources1
Modified residuei1312PhosphoserineCombined sources1
Modified residuei1456PhosphoserineCombined sources1
Modified residuei1469PhosphothreonineCombined sources1
Modified residuei1522PhosphoserineCombined sources1
Modified residuei1714PhosphoserineCombined sources1
Modified residuei1835Omega-N-methylarginineCombined sources1
Modified residuei1893Asymmetric dimethylarginineCombined sources1
Modified residuei1894Asymmetric dimethylarginineCombined sources1
Modified residuei1977Asymmetric dimethylarginineCombined sources1
Modified residuei1982Asymmetric dimethylarginineCombined sources1
Modified residuei1993Asymmetric dimethylarginineCombined sources1
Modified residuei2008Asymmetric dimethylarginineCombined sources1
Modified residuei2024Asymmetric dimethylarginineCombined sources1

Keywords - PTMi

Acetylation, Isopeptide bond, Methylation, Phosphoprotein, Ubl conjugation

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q9BTC0

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q9BTC0

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q9BTC0

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9BTC0

PeptideAtlas

More...
PeptideAtlasi
Q9BTC0

PRoteomics IDEntifications database

More...
PRIDEi
Q9BTC0

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
78967 [Q9BTC0-4]
78968 [Q9BTC0-1]
78969 [Q9BTC0-2]
78970 [Q9BTC0-3]

PTM databases

CarbonylDB database of protein carbonylation sites

More...
CarbonylDBi
Q9BTC0

GlyGen: Computational and Informatics Resources for Glycoscience

More...
GlyGeni
Q9BTC0, 12 sites, 2 O-linked glycans (12 sites)

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9BTC0

MetOSite database of methionine sulfoxide sites

More...
MetOSitei
Q9BTC0

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9BTC0

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Ubiquitous.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000101191, Expressed in epithelium of mammary gland and 230 other tissues

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9BTC0, HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
ENSG00000101191, Low tissue specificity

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts specifically (via PHD-type zinc finger) with histone H3 that is trimethylated at 'Lys-4' (H3K4me3), histone phosphorylation at 'Thr-3' or 'Thr-6' disrupts this binding and promotes translocation of DIDO1 from chromatin to the mitotic spindle during mitosis.

1 Publication

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
116266, 74 interactors

Protein interaction database and analysis system

More...
IntActi
Q9BTC0, 29 interactors

Molecular INTeraction database

More...
MINTi
Q9BTC0

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000266070

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q9BTC0, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

12240
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

Biological Magnetic Resonance Data Bank

More...
BMRBi
Q9BTC0

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q9BTC0

Database of comparative protein structure models

More...
ModBasei
Search...

Protein Data Bank in Europe - Knowledge Base

More...
PDBe-KBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini670 – 790TFIIS centralPROSITE-ProRule annotationAdd BLAST121

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni1 – 259DisorderedSequence analysisAdd BLAST259
Regioni431 – 456DisorderedSequence analysisAdd BLAST26
Regioni501 – 567DisorderedSequence analysisAdd BLAST67
Regioni584 – 618DisorderedSequence analysisAdd BLAST35
Regioni773 – 826DisorderedSequence analysisAdd BLAST54
Regioni860 – 947DisorderedSequence analysisAdd BLAST88
Regioni1013 – 1045DisorderedSequence analysisAdd BLAST33
Regioni1206 – 1427DisorderedSequence analysisAdd BLAST222
Regioni1453 – 1472DisorderedSequence analysisAdd BLAST20
Regioni1517 – 2240DisorderedSequence analysisAdd BLAST724

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi165 – 173Nuclear localization signalSequence analysis9
Motifi185 – 193Nuclear localization signalSequence analysis9

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular type of amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi1 – 44Basic and acidic residuesSequence analysisAdd BLAST44
Compositional biasi65 – 91Basic and acidic residuesSequence analysisAdd BLAST27
Compositional biasi94 – 134Polar residuesSequence analysisAdd BLAST41
Compositional biasi136 – 200Basic and acidic residuesSequence analysisAdd BLAST65
Compositional biasi227 – 259Basic and acidic residuesSequence analysisAdd BLAST33
Compositional biasi433 – 449Basic and acidic residuesSequence analysisAdd BLAST17
Compositional biasi529 – 543Basic and acidic residuesSequence analysisAdd BLAST15
Compositional biasi773 – 798Basic and acidic residuesSequence analysisAdd BLAST26
Compositional biasi866 – 894Basic and acidic residuesSequence analysisAdd BLAST29
Compositional biasi1028 – 1045Polar residuesSequence analysisAdd BLAST18
Compositional biasi1206 – 1221Basic and acidic residuesSequence analysisAdd BLAST16
Compositional biasi1256 – 1272Pro residuesSequence analysisAdd BLAST17
Compositional biasi1290 – 1315Polar residuesSequence analysisAdd BLAST26
Compositional biasi1394 – 1423Basic and acidic residuesSequence analysisAdd BLAST30
Compositional biasi1532 – 1557Polar residuesSequence analysisAdd BLAST26
Compositional biasi1840 – 1858Basic and acidic residuesSequence analysisAdd BLAST19
Compositional biasi1998 – 2012Polar residuesSequence analysisAdd BLAST15
Compositional biasi2067 – 2229Basic and acidic residuesSequence analysisAdd BLAST163

<p>This subsection of the 'Family and domains' section provides general information on the biological role of a domain. The term 'domain' is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The PHD-type zinc finger forms an aromatic cage around H3K4me3.

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri268 – 322PHD-typePROSITE-ProRule annotationAdd BLAST55

Keywords - Domaini

Zinc-finger

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG1632, Eukaryota
KOG1634, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000155532

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_000673_1_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9BTC0

Identification of Orthologs from Complete Genome Data

More...
OMAi
KAELFPQ

Database of Orthologous Groups

More...
OrthoDBi
174961at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9BTC0

TreeFam database of animal gene trees

More...
TreeFami
TF350578

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.10.472.30, 1 hit
3.30.40.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR033082, DIDO1
IPR012921, SPOC_C
IPR003618, TFIIS_cen_dom
IPR036575, TFIIS_cen_dom_sf
IPR019786, Zinc_finger_PHD-type_CS
IPR011011, Znf_FYVE_PHD
IPR001965, Znf_PHD
IPR019787, Znf_PHD-finger
IPR013083, Znf_RING/FYVE/PHD

The PANTHER Classification System

More...
PANTHERi
PTHR11477:SF13, PTHR11477:SF13, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00628, PHD, 1 hit
PF07744, SPOC, 1 hit
PF07500, TFIIS_M, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00249, PHD, 1 hit
SM00510, TFS2M, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF46942, SSF46942, 1 hit
SSF57903, SSF57903, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS51321, TFIIS_CENTRAL, 1 hit
PS01359, ZF_PHD_1, 1 hit
PS50016, ZF_PHD_2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 4 (identifier: Q9BTC0-4) [UniParc]FASTAAdd to basket
Also known as: DIDO3

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MDDKGDPSNE EAPKAIKPTS KEFRKTWGFR RTTIAKREGA GDAEADPLEP
60 70 80 90 100
PPPQQQLGLS LRRSGRQPKR TERVEQFLTI ARRRGRRSMP VSLEDSGEPT
110 120 130 140 150
SCPATDAETA SEGSVESASE TRSGPQSAST AVKERPASSE KVKGGDDHDD
160 170 180 190 200
TSDSDSDGLT LKELQNRLRR KREQEPTERP LKGIQSRLRK KRREEGPAET
210 220 230 240 250
VGSEASDTVE GVLPSKQEPE NDQGVVSQAG KDDRESKLEG KAAQDIKDEE
260 270 280 290 300
PGDLGRPKPE CEGYDPNALY CICRQPHNNR FMICCDRCEE WFHGDCVGIS
310 320 330 340 350
EARGRLLERN GEDYICPNCT ILQVQDETHS ETADQQEAKW RPGDADGTDC
360 370 380 390 400
TSIGTIEQKS SEDQGIKGRI EKAANPSGKK KLKIFQPVIE APGASKCIGP
410 420 430 440 450
GCCHVAQPDS VYCSNDCILK HAAATMKFLS SGKEQKPKPK EKMKMKPEKP
460 470 480 490 500
SLPKCGAQAG IKISSVHKRP APEKKETTVK KAVVVPARSE ALGKEAACES
510 520 530 540 550
STPSWASDHN YNAVKPEKTA APSPSLLYKS TKEDRRSEEK AAAMAASKKT
560 570 580 590 600
APPGSAVGKQ PAPRNLVPKK SSFANVAAAT PAIKKPPSGF KGTIPKRPWL
610 620 630 640 650
SATPSSGASA ARQAGPAPAA ATAASKKFPG SAALVGAVRK PVVPSVPMAS
660 670 680 690 700
PAPGRLGAMS AAPSQPNSQI RQNIRRSLKE ILWKRVNDSD DLIMTENEVG
710 720 730 740 750
KIALHIEKEM FNLFQVTDNR YKSKYRSIMF NLKDPKNQGL FHRVLREEIS
760 770 780 790 800
LAKLVRLKPE ELVSKELSTW KERPARSVME SRTKLHNESK KTAPRQEAIP
810 820 830 840 850
DLEDSPPVSD SEEQQESARA VPEKSTAPLL DVFSSMLKDT TSQHRAHLFD
860 870 880 890 900
LNCKICTGQV PSAEDEPAPK KQKLSASVKK EDLKSKHDSS APDPAPDSAD
910 920 930 940 950
EVMPEAVPEV ASEPGLESAS HPNVDRTYFP GPPGDGHPEP SPLEDLSPCP
960 970 980 990 1000
ASCGSGVVTT VTVSGRDPRT APSSSCTAVA SAASRPDSTH MVEARQDVPK
1010 1020 1030 1040 1050
PVLTSVMVPK SILAKPSSSP DPRYLSVPPS PNISTSESRS PPEGDTTLFL
1060 1070 1080 1090 1100
SRLSTIWKGF INMQSVAKFV TKAYPVSGCF DYLSEDLPDT IHIGGRIAPK
1110 1120 1130 1140 1150
TVWDYVGKLK SSVSKELCLI RFHPATEEEE VAYISLYSYF SSRGRFGVVA
1160 1170 1180 1190 1200
NNNRHVKDLY LIPLSAQDPV PSKLLPFEGP GLESPRPNII LGLVICQKIK
1210 1220 1230 1240 1250
RPANSGELDK MDEKRTRLQP EEADVPAYPK VATVPQSEKK PSKYPLCSAD
1260 1270 1280 1290 1300
AAVSTTPPGS PPPPPPLPEP PVLKVLSSLK PAAPSPATAA TTAAAASTAA
1310 1320 1330 1340 1350
SSTASSASKT ASPLEHILQT LFGKKKSFDP SAREPPGSTA GLPQEPKTTA
1360 1370 1380 1390 1400
EDGVPAPPLL DPIVQQFGQF SKDKALEEEE DDRPYDPEEE YDPERAFDTQ
1410 1420 1430 1440 1450
LVERGRRHEV ERAPEAAAAE REEVAYDPED ETILEEAKVT VDDLPNRMCA
1460 1470 1480 1490 1500
DVRRNSVERP AEPVAGAATP SLVEQQKMLE ELNKQIEEQK RQLEEQEEAL
1510 1520 1530 1540 1550
RQQRAAVGVS MAHFSVSDAL MSPPPKSSLP KAELFQQEQQ SADKPASLPP
1560 1570 1580 1590 1600
ASQASNHRDP RQARRLATET GEGEGEPLSR LSARGAQGAL PERDASRGGL
1610 1620 1630 1640 1650
VGQAPMPVPE EKEPASSPWA SGEKPPAGSE QDGWKAEPGE GTRPATVGDS
1660 1670 1680 1690 1700
SARPARRVLL PTPPCGALQP GFPLQHDGER DPFTCPGFAS QDKALGSAQY
1710 1720 1730 1740 1750
EDPRNLHSAG RSSSPAGETE GDREPQARPG EGTAPLPPPG QKVGGSQPPF
1760 1770 1780 1790 1800
QGQREPGPHA LGMSGLHGPN FPGPRGPAPP FPEENIASND GPRGPPPARF
1810 1820 1830 1840 1850
GAQKGPIPSL FSGQHGPPPY GDSRGPSPSY LGGPRGVAPS QFEERKDPHG
1860 1870 1880 1890 1900
EKREFQDAPY NEVTGAPAQF EGTEQAPFLG SRGGAPFQFG GQRRPLLSQL
1910 1920 1930 1940 1950
KGPRGGPPPS QFGGQRGPPP GHFVGPRGPH PSQFETARGP HPNQFEGPRG
1960 1970 1980 1990 2000
QAPNFMPGPR GIQPQQFEDQ RVHSPPRFTN QRAPAPLQFG GLRGSAPFSE
2010 2020 2030 2040 2050
KNEQTPSRFH FQGQAPQVMK PGPRPLLELP SHPPQHRKDR WEEAGPPSAL
2060 2070 2080 2090 2100
SSSAPGQGPE ADGQWASADF REGKGHEYRN QTFEGRQRER FDVGPKEKPL
2110 2120 2130 2140 2150
EEPDAQGRAS EDRRRERERG RNWSRERDWD RPREWDRHRD KDSSRDWDRN
2160 2170 2180 2190 2200
RERSANRDRE READRGKEWD RSRERSRNRE RERDRRRDRD RSRSRERDRD
2210 2220 2230 2240
KARDRERGRD RKDRSKSKES ARDPKPEASR ASDAGTASQA
Length:2,240
Mass (Da):243,873
Last modified:October 17, 2006 - v5
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i9B89361A24A72C58
GO
Isoform 1 (identifier: Q9BTC0-1) [UniParc]FASTAAdd to basket
Also known as: DIDO2

The sequence of this isoform differs from the canonical sequence as follows:
     1182-1189: LESPRPNI → KRRLSGWR
     1190-2240: Missing.

Show »
Length:1,189
Mass (Da):129,181
Checksum:i6C536EE25776C086
GO
Isoform 2 (identifier: Q9BTC0-2) [UniParc]FASTAAdd to basket
Also known as: DIDO1

The sequence of this isoform differs from the canonical sequence as follows:
     530-544: STKEDRRSEEKAAAM → CSGKYSYSLHPSLIA
     545-2240: Missing.

Show »
Length:544
Mass (Da):59,461
Checksum:i192BE2A77ED5FADA
GO
Isoform 3 (identifier: Q9BTC0-3) [UniParc]FASTAAdd to basket
Also known as: a

The sequence of this isoform differs from the canonical sequence as follows:
     530-562: STKEDRRSEEKAAAMAASKKTAPPGSAVGKQPA → CMYHLGVGLLDPSRSFWIAIPWACPGLGVAALC
     563-2240: Missing.

Show »
Length:562
Mass (Da):61,354
Checksum:i91A714668F9C5C12
GO

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAA20791 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti252G → E in BAA92094 (PubMed:14702039).Curated1
Isoform 2 (identifier: Q9BTC0-2)
Sequence conflicti535S → L in AAH00770 (PubMed:15489334).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_02831013P → L. Corresponds to variant dbSNP:rs6090161Ensembl.1
Natural variantiVAR_028311276P → L. Corresponds to variant dbSNP:rs6090160Ensembl.1
Natural variantiVAR_057093544M → T1 PublicationCorresponds to variant dbSNP:rs1883848Ensembl.1
Natural variantiVAR_057094556A → T1 PublicationCorresponds to variant dbSNP:rs1883847Ensembl.1
Natural variantiVAR_057095793A → G. Corresponds to variant dbSNP:rs750077Ensembl.1
Natural variantiVAR_0570961220P → Q. Corresponds to variant dbSNP:rs6011441Ensembl.1
Natural variantiVAR_0617401708S → C. Corresponds to variant dbSNP:rs41282984Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_007211530 – 562STKED…GKQPA → CMYHLGVGLLDPSRSFWIAI PWACPGLGVAALC in isoform 3. 2 PublicationsAdd BLAST33
Alternative sequenceiVSP_007209530 – 544STKED…KAAAM → CSGKYSYSLHPSLIA in isoform 2. 1 PublicationAdd BLAST15
Alternative sequenceiVSP_007210545 – 2240Missing in isoform 2. 1 PublicationAdd BLAST1696
Alternative sequenceiVSP_007212563 – 2240Missing in isoform 3. 2 PublicationsAdd BLAST1678
Alternative sequenceiVSP_0172251182 – 1189LESPRPNI → KRRLSGWR in isoform 1. 3 Publications8
Alternative sequenceiVSP_0172261190 – 2240Missing in isoform 1. 3 PublicationsAdd BLAST1051

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AY481571 mRNA Translation: AAS49898.1
AY481572 mRNA Translation: AAS49899.1
AB002331 mRNA Translation: BAA20791.2 Different initiation.
AK002127 mRNA Translation: BAA92094.1
AL117379 Genomic DNA No translation available.
AL035669 Genomic DNA No translation available.
CH471077 Genomic DNA Translation: EAW75322.1
CH471077 Genomic DNA Translation: EAW75323.1
BC000770 mRNA Translation: AAH00770.1
BC004237 mRNA Translation: AAH04237.1
BC012757 mRNA No translation available.
BC014489 mRNA Translation: AAH14489.1
BC137177 mRNA Translation: AAI37178.1
AL133063 mRNA Translation: CAB61387.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS13508.2 [Q9BTC0-1]
CCDS13509.1 [Q9BTC0-3]
CCDS33506.1 [Q9BTC0-4]

NCBI Reference Sequences

More...
RefSeqi
NP_001180298.1, NM_001193369.1 [Q9BTC0-4]
NP_001180299.1, NM_001193370.1 [Q9BTC0-1]
NP_071388.2, NM_022105.4 [Q9BTC0-3]
NP_149072.2, NM_033081.2 [Q9BTC0-4]
NP_542986.1, NM_080796.3 [Q9BTC0-3]
NP_542987.2, NM_080797.3 [Q9BTC0-1]
XP_011526811.1, XM_011528509.2 [Q9BTC0-4]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000266070; ENSP00000266070; ENSG00000101191 [Q9BTC0-4]
ENST00000354665; ENSP00000346692; ENSG00000101191 [Q9BTC0-3]
ENST00000370366; ENSP00000359391; ENSG00000101191 [Q9BTC0-2]
ENST00000370368; ENSP00000359394; ENSG00000101191 [Q9BTC0-3]
ENST00000370371; ENSP00000359397; ENSG00000101191 [Q9BTC0-3]
ENST00000395340; ENSP00000378749; ENSG00000101191 [Q9BTC0-1]
ENST00000395343; ENSP00000378752; ENSG00000101191 [Q9BTC0-4]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
11083

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:11083

UCSC genome browser

More...
UCSCi
uc002ydr.3, human [Q9BTC0-4]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY481571 mRNA Translation: AAS49898.1
AY481572 mRNA Translation: AAS49899.1
AB002331 mRNA Translation: BAA20791.2 Different initiation.
AK002127 mRNA Translation: BAA92094.1
AL117379 Genomic DNA No translation available.
AL035669 Genomic DNA No translation available.
CH471077 Genomic DNA Translation: EAW75322.1
CH471077 Genomic DNA Translation: EAW75323.1
BC000770 mRNA Translation: AAH00770.1
BC004237 mRNA Translation: AAH04237.1
BC012757 mRNA No translation available.
BC014489 mRNA Translation: AAH14489.1
BC137177 mRNA Translation: AAI37178.1
AL133063 mRNA Translation: CAB61387.1
CCDSiCCDS13508.2 [Q9BTC0-1]
CCDS13509.1 [Q9BTC0-3]
CCDS33506.1 [Q9BTC0-4]
RefSeqiNP_001180298.1, NM_001193369.1 [Q9BTC0-4]
NP_001180299.1, NM_001193370.1 [Q9BTC0-1]
NP_071388.2, NM_022105.4 [Q9BTC0-3]
NP_149072.2, NM_033081.2 [Q9BTC0-4]
NP_542986.1, NM_080796.3 [Q9BTC0-3]
NP_542987.2, NM_080797.3 [Q9BTC0-1]
XP_011526811.1, XM_011528509.2 [Q9BTC0-4]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2M3HNMR-A265-322[»]
4L7XX-ray1.35A266-325[»]
BMRBiQ9BTC0
SMRiQ9BTC0
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGRIDi116266, 74 interactors
IntActiQ9BTC0, 29 interactors
MINTiQ9BTC0
STRINGi9606.ENSP00000266070

PTM databases

CarbonylDBiQ9BTC0
GlyGeniQ9BTC0, 12 sites, 2 O-linked glycans (12 sites)
iPTMnetiQ9BTC0
MetOSiteiQ9BTC0
PhosphoSitePlusiQ9BTC0

Genetic variation databases

BioMutaiDIDO1
DMDMi116241332

Proteomic databases

EPDiQ9BTC0
jPOSTiQ9BTC0
MassIVEiQ9BTC0
PaxDbiQ9BTC0
PeptideAtlasiQ9BTC0
PRIDEiQ9BTC0
ProteomicsDBi78967 [Q9BTC0-4]
78968 [Q9BTC0-1]
78969 [Q9BTC0-2]
78970 [Q9BTC0-3]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
3820, 263 antibodies

The DNASU plasmid repository

More...
DNASUi
11083

Genome annotation databases

EnsembliENST00000266070; ENSP00000266070; ENSG00000101191 [Q9BTC0-4]
ENST00000354665; ENSP00000346692; ENSG00000101191 [Q9BTC0-3]
ENST00000370366; ENSP00000359391; ENSG00000101191 [Q9BTC0-2]
ENST00000370368; ENSP00000359394; ENSG00000101191 [Q9BTC0-3]
ENST00000370371; ENSP00000359397; ENSG00000101191 [Q9BTC0-3]
ENST00000395340; ENSP00000378749; ENSG00000101191 [Q9BTC0-1]
ENST00000395343; ENSP00000378752; ENSG00000101191 [Q9BTC0-4]
GeneIDi11083
KEGGihsa:11083
UCSCiuc002ydr.3, human [Q9BTC0-4]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
11083
DisGeNETi11083

GeneCards: human genes, protein and diseases

More...
GeneCardsi
DIDO1
HGNCiHGNC:2680, DIDO1
HPAiENSG00000101191, Low tissue specificity
MIMi604140, gene
neXtProtiNX_Q9BTC0
OpenTargetsiENSG00000101191
PharmGKBiPA27147
VEuPathDBiHostDB:ENSG00000101191

Human Unidentified Gene-Encoded large proteins database

More...
HUGEi
Search...

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG1632, Eukaryota
KOG1634, Eukaryota
GeneTreeiENSGT00940000155532
HOGENOMiCLU_000673_1_0_1
InParanoidiQ9BTC0
OMAiKAELFPQ
OrthoDBi174961at2759
PhylomeDBiQ9BTC0
TreeFamiTF350578

Enzyme and pathway databases

PathwayCommonsiQ9BTC0
ReactomeiR-HSA-1221632, Meiotic synapsis [Q9BTC0-1]
SIGNORiQ9BTC0

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
11083, 250 hits in 1023 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
DIDO1, human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
DIDO1

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
11083
PharosiQ9BTC0, Tbio

Protein Ontology

More...
PROi
PR:Q9BTC0
RNActiQ9BTC0, protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000101191, Expressed in epithelium of mammary gland and 230 other tissues
GenevisibleiQ9BTC0, HS

Family and domain databases

Gene3Di1.10.472.30, 1 hit
3.30.40.10, 1 hit
InterProiView protein in InterPro
IPR033082, DIDO1
IPR012921, SPOC_C
IPR003618, TFIIS_cen_dom
IPR036575, TFIIS_cen_dom_sf
IPR019786, Zinc_finger_PHD-type_CS
IPR011011, Znf_FYVE_PHD
IPR001965, Znf_PHD
IPR019787, Znf_PHD-finger
IPR013083, Znf_RING/FYVE/PHD
PANTHERiPTHR11477:SF13, PTHR11477:SF13, 1 hit
PfamiView protein in Pfam
PF00628, PHD, 1 hit
PF07744, SPOC, 1 hit
PF07500, TFIIS_M, 1 hit
SMARTiView protein in SMART
SM00249, PHD, 1 hit
SM00510, TFS2M, 1 hit
SUPFAMiSSF46942, SSF46942, 1 hit
SSF57903, SSF57903, 1 hit
PROSITEiView protein in PROSITE
PS51321, TFIIS_CENTRAL, 1 hit
PS01359, ZF_PHD_1, 1 hit
PS50016, ZF_PHD_2, 1 hit

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiDIDO1_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9BTC0
Secondary accession number(s): A8MY65
, B9EH82, E1P5I1, O15043, Q3ZTL7, Q3ZTL8, Q4VXS1, Q4VXS2, Q4VXV8, Q4VXV9, Q96D72, Q9BQW0, Q9BW03, Q9H4G6, Q9H4G7, Q9NTU8, Q9NUM8, Q9UFB6
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 23, 2003
Last sequence update: October 17, 2006
Last modified: September 29, 2021
This is version 194 of the entry and version 5 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome 20
    Human chromosome 20: entries, gene names and cross-references to MIM
  2. Human entries with genetic variants
    List of human entries with genetic variants
  3. Human variants curated from literature reports
    Index of human variants curated from literature reports
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again