Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Nicolin-1

Gene

NICN1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at transcript leveli

Functioni

Enzyme and pathway databases

ReactomeiR-HSA-8955332 Carboxyterminal post-translational modifications of tubulin

Names & Taxonomyi

Protein namesi
Recommended name:
Nicolin-1
Alternative name(s):
NPCEDRG
Tubulin polyglutamylase complex subunit 5
Short name:
PGs5
Gene namesi
Name:NICN1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 3

Organism-specific databases

EuPathDBiHostDB:ENSG00000145029.11
HGNCiHGNC:18317 NICN1
MIMi611516 gene
neXtProtiNX_Q9BSH3

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Microtubule, Nucleus

Pathology & Biotechi

Organism-specific databases

DisGeNETi84276
OpenTargetsiENSG00000145029
ENSG00000283189
PharmGKBiPA31623

Polymorphism and mutation databases

BioMutaiNICN1
DMDMi51701690

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000968141 – 213Nicolin-1Add BLAST213

Proteomic databases

PaxDbiQ9BSH3
PeptideAtlasiQ9BSH3
PRIDEiQ9BSH3
ProteomicsDBi78891
78892 [Q9BSH3-2]

PTM databases

iPTMnetiQ9BSH3
PhosphoSitePlusiQ9BSH3

Expressioni

Tissue specificityi

High expression level is found in brain, testis, liver and kidney. Weak expression in spleen, leukocytes, small intestine and colon.1 Publication

Gene expression databases

BgeeiENSG00000145029
CleanExiHS_NICN1
ExpressionAtlasiQ9BSH3 baseline and differential
GenevisibleiQ9BSH3 HS

Organism-specific databases

HPAiHPA058014

Interactioni

Subunit structurei

Part of the neuronal tubulin polyglutamylase complex which contains TPGS1, TPGS2, TTLL1, LRRC49 and NICN1.By similarity

Protein-protein interaction databases

BioGridi124003, 9 interactors
IntActiQ9BSH3, 2 interactors
STRINGi9606.ENSP00000273598

Structurei

3D structure databases

ProteinModelPortaliQ9BSH3
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Phylogenomic databases

eggNOGiENOG410IHPW Eukaryota
ENOG4111GDK LUCA
GeneTreeiENSGT00390000001505
HOGENOMiHOG000006705
HOVERGENiHBG052619
InParanoidiQ9BSH3
KOiK16607
OrthoDBiEOG091G0NXM
PhylomeDBiQ9BSH3
TreeFamiTF329753

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9BSH3-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSRVLVPCHV KGSVALQVGD VRTSQGRPGV LVIDVTFPSV APFELQEITF
60 70 80 90 100
KNYYTAFLSI RVRQYTSAHT PAKWVTCLRD YCLMPDPHSE EGAQEYVSLF
110 120 130 140 150
KHQMLCDMAR ISELRLILRQ PSPLWLSFTV EELQIYQQGP KSPSVTFPKW
160 170 180 190 200
LSHPVPCEQP ALLREGLPDP SRVSSEVQQM WALTEMIRAS HTSARIGRFD
210
VDGCYDLNLL SYT
Length:213
Mass (Da):24,202
Last modified:June 1, 2001 - v1
Checksum:i2170A24989952652
GO
Isoform 2 (identifier: Q9BSH3-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     166-213: GLPDPSRVSSEVQQMWALTEMIRASHTSARIGRFDVDGCYDLNLLSYT → VSPHPR

Show »
Length:171
Mass (Da):19,506
Checksum:iB331EF436850AE46
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti45 – 46Missing in AAN52734 (Ref. 2) Curated2

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_011420166 – 213GLPDP…LLSYT → VSPHPR in isoform 2. 1 PublicationAdd BLAST48

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ299740 mRNA Translation: CAC82516.1
AF538150 mRNA Translation: AAN52734.1
BC005050 mRNA Translation: AAH05050.1
BC050653 mRNA Translation: AAH50653.1
CCDSiCCDS2798.1 [Q9BSH3-1]
RefSeqiNP_115692.1, NM_032316.3 [Q9BSH3-1]
UniGeneiHs.191460

Genome annotation databases

EnsembliENST00000273598; ENSP00000273598; ENSG00000145029 [Q9BSH3-1]
ENST00000423832; ENSP00000413115; ENSG00000145029 [Q9BSH3-1]
ENST00000615713; ENSP00000478287; ENSG00000145029 [Q9BSH3-1]
GeneIDi84276
KEGGihsa:84276
UCSCiuc003cwz.2 human [Q9BSH3-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiNICN1_HUMAN
AccessioniPrimary (citable) accession number: Q9BSH3
Secondary accession number(s): Q8IZQ2
Entry historyiIntegrated into UniProtKB/Swiss-Prot: August 31, 2004
Last sequence update: June 1, 2001
Last modified: June 20, 2018
This is version 106 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 3
    Human chromosome 3: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health