Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 111 (13 Feb 2019)
Sequence version 1 (01 Jun 2001)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Nicolin-1

Gene

NICN1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-8955332 Carboxyterminal post-translational modifications of tubulin

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Nicolin-1
Alternative name(s):
NPCEDRG
Tubulin polyglutamylase complex subunit 5
Short name:
PGs5
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:NICN1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 3

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000145029.11

Human Gene Nomenclature Database

More...
HGNCi
HGNC:18317 NICN1

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
611516 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q9BSH3

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Microtubule, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
84276

Open Targets

More...
OpenTargetsi
ENSG00000145029
ENSG00000283189

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA31623

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
NICN1

Domain mapping of disease mutations (DMDM)

More...
DMDMi
51701690

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000968141 – 213Nicolin-1Add BLAST213

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9BSH3

PeptideAtlas

More...
PeptideAtlasi
Q9BSH3

PRoteomics IDEntifications database

More...
PRIDEi
Q9BSH3

ProteomicsDB human proteome resource

More...
ProteomicsDBi
78891
78892 [Q9BSH3-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9BSH3

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9BSH3

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

High expression level is found in brain, testis, liver and kidney. Weak expression in spleen, leukocytes, small intestine and colon.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000145029 Expressed in 190 organ(s), highest expression level in right frontal lobe

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q9BSH3 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9BSH3 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA058014

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Part of the neuronal tubulin polyglutamylase complex which contains TPGS1, TPGS2, TTLL1, LRRC49 and NICN1.By similarity

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
124003, 9 interactors

Protein interaction database and analysis system

More...
IntActi
Q9BSH3, 9 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000273598

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
Q9BSH3

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IHPW Eukaryota
ENOG4111GDK LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000001505

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000006705

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG052619

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9BSH3

KEGG Orthology (KO)

More...
KOi
K16607

Database of Orthologous Groups

More...
OrthoDBi
1638449at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9BSH3

TreeFam database of animal gene trees

More...
TreeFami
TF329753

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR040235 Nicolin-1

The PANTHER Classification System

More...
PANTHERi
PTHR31239 PTHR31239, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9BSH3-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSRVLVPCHV KGSVALQVGD VRTSQGRPGV LVIDVTFPSV APFELQEITF
60 70 80 90 100
KNYYTAFLSI RVRQYTSAHT PAKWVTCLRD YCLMPDPHSE EGAQEYVSLF
110 120 130 140 150
KHQMLCDMAR ISELRLILRQ PSPLWLSFTV EELQIYQQGP KSPSVTFPKW
160 170 180 190 200
LSHPVPCEQP ALLREGLPDP SRVSSEVQQM WALTEMIRAS HTSARIGRFD
210
VDGCYDLNLL SYT
Length:213
Mass (Da):24,202
Last modified:June 1, 2001 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i2170A24989952652
GO
Isoform 2 (identifier: Q9BSH3-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     166-213: GLPDPSRVSSEVQQMWALTEMIRASHTSARIGRFDVDGCYDLNLLSYT → VSPHPR

Show »
Length:171
Mass (Da):19,506
Checksum:iB331EF436850AE46
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
B4DX77B4DX77_HUMAN
cDNA FLJ52908, highly similar to Ni...
NICN1
175Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti45 – 46Missing in AAN52734 (Ref. 2) Curated2

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_011420166 – 213GLPDP…LLSYT → VSPHPR in isoform 2. 1 PublicationAdd BLAST48

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AJ299740 mRNA Translation: CAC82516.1
AF538150 mRNA Translation: AAN52734.1
BC005050 mRNA Translation: AAH05050.1
BC050653 mRNA Translation: AAH50653.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS2798.1 [Q9BSH3-1]

NCBI Reference Sequences

More...
RefSeqi
NP_115692.1, NM_032316.3 [Q9BSH3-1]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.191460

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000273598; ENSP00000273598; ENSG00000145029 [Q9BSH3-1]
ENST00000423832; ENSP00000413115; ENSG00000145029 [Q9BSH3-1]
ENST00000615713; ENSP00000478287; ENSG00000145029 [Q9BSH3-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
84276

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:84276

UCSC genome browser

More...
UCSCi
uc003cwz.2 human [Q9BSH3-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ299740 mRNA Translation: CAC82516.1
AF538150 mRNA Translation: AAN52734.1
BC005050 mRNA Translation: AAH05050.1
BC050653 mRNA Translation: AAH50653.1
CCDSiCCDS2798.1 [Q9BSH3-1]
RefSeqiNP_115692.1, NM_032316.3 [Q9BSH3-1]
UniGeneiHs.191460

3D structure databases

ProteinModelPortaliQ9BSH3
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi124003, 9 interactors
IntActiQ9BSH3, 9 interactors
STRINGi9606.ENSP00000273598

PTM databases

iPTMnetiQ9BSH3
PhosphoSitePlusiQ9BSH3

Polymorphism and mutation databases

BioMutaiNICN1
DMDMi51701690

Proteomic databases

PaxDbiQ9BSH3
PeptideAtlasiQ9BSH3
PRIDEiQ9BSH3
ProteomicsDBi78891
78892 [Q9BSH3-2]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
84276
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000273598; ENSP00000273598; ENSG00000145029 [Q9BSH3-1]
ENST00000423832; ENSP00000413115; ENSG00000145029 [Q9BSH3-1]
ENST00000615713; ENSP00000478287; ENSG00000145029 [Q9BSH3-1]
GeneIDi84276
KEGGihsa:84276
UCSCiuc003cwz.2 human [Q9BSH3-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
84276
DisGeNETi84276
EuPathDBiHostDB:ENSG00000145029.11

GeneCards: human genes, protein and diseases

More...
GeneCardsi
NICN1
HGNCiHGNC:18317 NICN1
HPAiHPA058014
MIMi611516 gene
neXtProtiNX_Q9BSH3
OpenTargetsiENSG00000145029
ENSG00000283189
PharmGKBiPA31623

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG410IHPW Eukaryota
ENOG4111GDK LUCA
GeneTreeiENSGT00390000001505
HOGENOMiHOG000006705
HOVERGENiHBG052619
InParanoidiQ9BSH3
KOiK16607
OrthoDBi1638449at2759
PhylomeDBiQ9BSH3
TreeFamiTF329753

Enzyme and pathway databases

ReactomeiR-HSA-8955332 Carboxyterminal post-translational modifications of tubulin

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
NICN1 human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
84276

Protein Ontology

More...
PROi
PR:Q9BSH3

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000145029 Expressed in 190 organ(s), highest expression level in right frontal lobe
ExpressionAtlasiQ9BSH3 baseline and differential
GenevisibleiQ9BSH3 HS

Family and domain databases

InterProiView protein in InterPro
IPR040235 Nicolin-1
PANTHERiPTHR31239 PTHR31239, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiNICN1_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9BSH3
Secondary accession number(s): Q8IZQ2
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: August 31, 2004
Last sequence update: June 1, 2001
Last modified: February 13, 2019
This is version 111 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 3
    Human chromosome 3: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again