Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - Q9BSG5 (RTBDN_HUMAN)

Entry version 134 (10 Feb 2021)
Sequence version 2 (06 Dec 2005)
Previous versions | rss
Add a publicationFeedback
Protein

Retbindin

Gene

RTBDN

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Riboflavin-binding protein which might have a role in retinal flavin transport.By similarity

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		Q9BSG5

Protein family/group databases

Transport Classification Database

More...TCDBi		9.B.92.2.1, the folate receptor (fr) family

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Retbindin
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:RTBDN
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 19

Organism-specific databases

Human Gene Nomenclature Database

More...HGNCi		HGNC:30310, RTBDN

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		609553, gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_Q9BSG5

Eukaryotic Pathogen, Vector and Host Database Resources

More...VEuPathDBi		HostDB:ENSG00000132026.13

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Cell membrane, Extracellular matrix, Membrane, Secreted

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...DisGeNETi		83546

Open Targets

More...OpenTargetsi		ENSG00000132026

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA144596387

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		Q9BSG5, Tdark

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		RTBDN

Domain mapping of disease mutations (DMDM)

More...DMDMi		83305682

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 30Sequence analysisAdd BLAST30
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000004317431 – 229RetbindinAdd BLAST199

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi79 ↔ 149By similarity
Disulfide bondi86 ↔ 126By similarity
Disulfide bondi119 ↔ 163By similarity
Disulfide bondi132 ↔ 145By similarity

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Not N-glycosylated.By similarity

Keywords - PTMi

Disulfide bond

Proteomic databases

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		Q9BSG5

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q9BSG5

PeptideAtlas

More...PeptideAtlasi		Q9BSG5

PRoteomics IDEntifications database

More...PRIDEi		Q9BSG5

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		78889 [Q9BSG5-1]
78890 [Q9BSG5-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q9BSG5

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q9BSG5

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in peripheral retina (at protein level).1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000132026, Expressed in adenohypophysis and 91 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		Q9BSG5, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q9BSG5, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000132026, Group enriched (brain, pituitary gland, retina)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		123678, 9 interactors

Protein interaction database and analysis system

More...IntActi		Q9BSG5, 7 interactors

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000326253

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		Q9BSG5, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		Q9BSG5

Database of comparative protein structure models

More...ModBasei		Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the folate receptor family.Curated

Keywords - Domaini

Signal

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		ENOG502RYYP, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00950000183144

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q9BSG5

Identification of Orthologs from Complete Genome Data

More...OMAi		WFATCES

Database of Orthologous Groups

More...OrthoDBi		1534387at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q9BSG5

TreeFam database of animal gene trees

More...TreeFami		TF337710

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR004269, Folate_rcpt
IPR018143, Folate_rcpt-like

The PANTHER Classification System

More...PANTHERi		PTHR10517, PTHR10517, 1 hit

Pfam protein domain database

More...Pfami		View protein in Pfam
PF03024, Folate_rec, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 9 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9BSG5-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MDCRVHMRPI GLTWVLQLTL AWILLEACGG SRPLQARSQQ HHGLAADLGK 
        60         70         80         90        100
GKLHLAGPCC PSEMDTTETS GPGNHPERCG VPSPECESFL EHLQRALRSR 
       110        120        130        140        150
FRLRLLGVRQ AQPLCEELCQ AWFANCEDDI TCGPTWLPLS EKRGCEPSCL 
       160        170        180        190        200
TYGQTFADGT DLCRSALGHA LPVAAPGARH CFNISISAVP RPRPGRRGRE 
       210        220 
APSRRSRSPR TSILDAAGSG SGSGSGSGP
Length:229
Mass (Da):24,615
Last modified:December 6, 2005 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iC049E48426403D52
GO
Isoform 2 (identifier: Q9BSG5-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MDEALETQLKTSRGRFSATESLPTLELLSQVDM

Show »
Length:261
Mass (Da):28,164
Checksum:i8514D01F9237AEFE
GO
Isoform 3 (identifier: Q9BSG5-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MARQLLSQVDM

Show »
Length:239
Mass (Da):25,757
Checksum:i7745D38B08237F2A
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 9 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
K7ENA4K7ENA4_HUMAN
Retbindin
RTBDN
174Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
K7EIS2K7EIS2_HUMAN
Retbindin
RTBDN
214Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
K7EM70K7EM70_HUMAN
Retbindin
RTBDN
193Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
K7EN64K7EN64_HUMAN
Retbindin
RTBDN
130Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
K7EKV3K7EKV3_HUMAN
Retbindin
RTBDN
186Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
K7EQL9K7EQL9_HUMAN
Retbindin
RTBDN
184Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
K7ESL8K7ESL8_HUMAN
Retbindin
RTBDN
113Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
K7ESG0K7ESG0_HUMAN
Retbindin
RTBDN
205Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
K7ES48K7ES48_HUMAN
Retbindin
RTBDN
70Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_049053198G → A. Corresponds to variant dbSNP:rs13628Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0376661M → MDEALETQLKTSRGRFSATE SLPTLELLSQVDM in isoform 2. 1 Publication1
Alternative sequenceiVSP_0469031M → MARQLLSQVDM in isoform 3. 1 Publication1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AY028917 mRNA Translation: AAK26169.1
AB593122 mRNA Translation: BAJ84062.1
AC020934 Genomic DNA No translation available.
BC005063 mRNA Translation: AAH05063.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS12283.1 [Q9BSG5-2]
CCDS45994.1 [Q9BSG5-1]
CCDS59355.1 [Q9BSG5-1]

NCBI Reference Sequences

More...RefSeqi		NP_001074466.1, NM_001080997.2 [Q9BSG5-1]
NP_001257370.1, NM_001270441.1 [Q9BSG5-1]
NP_001257371.1, NM_001270442.1
NP_001257372.1, NM_001270443.1 [Q9BSG5-1]
NP_001257373.1, NM_001270444.1 [Q9BSG5-1]
NP_001257374.1, NM_001270445.1
NP_113617.1, NM_031429.2 [Q9BSG5-2]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000322912; ENSP00000326253; ENSG00000132026 [Q9BSG5-2]
ENST00000393233; ENSP00000376925; ENSG00000132026 [Q9BSG5-1]
ENST00000458671; ENSP00000416375; ENSG00000132026 [Q9BSG5-1]
ENST00000592204; ENSP00000466765; ENSG00000132026 [Q9BSG5-3]
ENST00000674343; ENSP00000501410; ENSG00000132026 [Q9BSG5-1]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		83546

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:83546

UCSC genome browser

More...UCSCi		uc002mvi.5, human [Q9BSG5-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY028917 mRNA Translation: AAK26169.1
AB593122 mRNA Translation: BAJ84062.1
AC020934 Genomic DNA No translation available.
BC005063 mRNA Translation: AAH05063.1
CCDSiCCDS12283.1 [Q9BSG5-2]
CCDS45994.1 [Q9BSG5-1]
CCDS59355.1 [Q9BSG5-1]
RefSeqiNP_001074466.1, NM_001080997.2 [Q9BSG5-1]
NP_001257370.1, NM_001270441.1 [Q9BSG5-1]
NP_001257371.1, NM_001270442.1
NP_001257372.1, NM_001270443.1 [Q9BSG5-1]
NP_001257373.1, NM_001270444.1 [Q9BSG5-1]
NP_001257374.1, NM_001270445.1
NP_113617.1, NM_031429.2 [Q9BSG5-2]

3D structure databases

SMRiQ9BSG5
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi123678, 9 interactors
IntActiQ9BSG5, 7 interactors
STRINGi9606.ENSP00000326253

Protein family/group databases

TCDBi9.B.92.2.1, the folate receptor (fr) family

PTM databases

iPTMnetiQ9BSG5
PhosphoSitePlusiQ9BSG5

Genetic variation databases

BioMutaiRTBDN
DMDMi83305682

Proteomic databases

MassIVEiQ9BSG5
PaxDbiQ9BSG5
PeptideAtlasiQ9BSG5
PRIDEiQ9BSG5
ProteomicsDBi78889 [Q9BSG5-1]
78890 [Q9BSG5-2]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		65265, 46 antibodies

The DNASU plasmid repository

More...DNASUi		83546

Genome annotation databases

EnsembliENST00000322912; ENSP00000326253; ENSG00000132026 [Q9BSG5-2]
ENST00000393233; ENSP00000376925; ENSG00000132026 [Q9BSG5-1]
ENST00000458671; ENSP00000416375; ENSG00000132026 [Q9BSG5-1]
ENST00000592204; ENSP00000466765; ENSG00000132026 [Q9BSG5-3]
ENST00000674343; ENSP00000501410; ENSG00000132026 [Q9BSG5-1]
GeneIDi83546
KEGGihsa:83546
UCSCiuc002mvi.5, human [Q9BSG5-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		83546
DisGeNETi83546

GeneCards: human genes, protein and diseases

More...GeneCardsi		RTBDN
HGNCiHGNC:30310, RTBDN
HPAiENSG00000132026, Group enriched (brain, pituitary gland, retina)
MIMi609553, gene
neXtProtiNX_Q9BSG5
OpenTargetsiENSG00000132026
PharmGKBiPA144596387
VEuPathDBiHostDB:ENSG00000132026.13

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiENOG502RYYP, Eukaryota
GeneTreeiENSGT00950000183144
InParanoidiQ9BSG5
OMAiWFATCES
OrthoDBi1534387at2759
PhylomeDBiQ9BSG5
TreeFamiTF337710

Enzyme and pathway databases

PathwayCommonsiQ9BSG5

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		83546, 10 hits in 874 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		RTBDN, human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		83546
PharosiQ9BSG5, Tdark

Protein Ontology

More...PROi		PR:Q9BSG5
RNActiQ9BSG5, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000132026, Expressed in adenohypophysis and 91 other tissues
ExpressionAtlasiQ9BSG5, baseline and differential
GenevisibleiQ9BSG5, HS

Family and domain databases

InterProiView protein in InterPro
IPR004269, Folate_rcpt
IPR018143, Folate_rcpt-like
PANTHERiPTHR10517, PTHR10517, 1 hit
PfamiView protein in Pfam
PF03024, Folate_rec, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiRTBDN_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9BSG5
Secondary accession number(s): F1T0I8, Q9BWT5
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: December 6, 2005
Last sequence update: December 6, 2005
Last modified: February 10, 2021
This is version 134 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Human variants curated from literature reports
    Index of human variants curated from literature reports
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families
  4. Human chromosome 19
    Human chromosome 19: entries, gene names and cross-references to MIM
  5. Human entries with genetic variants
    List of human entries with genetic variants
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again