Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 143 (17 Jun 2020)
Sequence version 2 (23 Nov 2004)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

BTB/POZ domain-containing protein 10

Gene

BTBD10

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:4 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Plays a major role as an activator of AKT family members by inhibiting PPP2CA-mediated dephosphorylation, thereby keeping AKTs activated. Plays a role in preventing motor neuronal death and accelerating the growth of pancreatic beta cells.By similarity

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Biological processi

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
BTB/POZ domain-containing protein 10
Alternative name(s):
Glucose metabolism-related protein 11 Publication
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:BTBD10
Synonyms:GMRP11 Publication
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 11

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000148925.10

Human Gene Nomenclature Database

More...
HGNCi
HGNC:21445 BTBD10

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
615933 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q9BSF8

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Cytoplasm, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
84280

Open Targets

More...
OpenTargetsi
ENSG00000148925

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA142672543

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q9BSF8 Tbio

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
BTBD10

Domain mapping of disease mutations (DMDM)

More...
DMDMi
74733002

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002289851 – 475BTB/POZ domain-containing protein 10Add BLAST475

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q9BSF8

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q9BSF8

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q9BSF8

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q9BSF8

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9BSF8

PeptideAtlas

More...
PeptideAtlasi
Q9BSF8

PRoteomics IDEntifications database

More...
PRIDEi
Q9BSF8

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
6400
78886 [Q9BSF8-1]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9BSF8

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9BSF8

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Ubiquitously expressed. Highly expressed in adult brain, testis, aorta and small intestine and weakly expressed in the heart, lung, liver, kidney, pancreas, spleen, thymus, prostate, ovary and colon. Down-regulated in glioma.2 Publications

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000148925 Expressed in corpus callosum and 204 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q9BSF8 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9BSF8 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
ENSG00000148925 Low tissue specificity

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts (via C-terminal 330-amino-acid region) with AKT1; AKT2 and AKT3.

Interacts with PPP2CA and PPP1CA.

By similarity

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
124007, 14 interactors

Protein interaction database and analysis system

More...
IntActi
Q9BSF8, 11 interactors

Molecular INTeraction database

More...
MINTi
Q9BSF8

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000431186

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q9BSF8 protein

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini167 – 241BTBAdd BLAST75

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni146 – 475Interaction with AKT family membersBy similarityAdd BLAST330

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi106 – 142Ser-richAdd BLAST37

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG3840 Eukaryota
ENOG410XSS5 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000007975

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9BSF8

KEGG Orthology (KO)

More...
KOi
K10482

Identification of Orthologs from Complete Genome Data

More...
OMAi
WDRKLHN

Database of Orthologous Groups

More...
OrthoDBi
390051at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9BSF8

TreeFam database of animal gene trees

More...
TreeFami
TF314369

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR000210 BTB/POZ_dom
IPR039886 BTBD10/KCTD20
IPR039885 BTBD10/KCTD20_BTB/POZ
IPR011333 SKP1/BTB/POZ_sf

The PANTHER Classification System

More...
PANTHERi
PTHR21637 PTHR21637, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF16017 BTB_3, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00225 BTB, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF54695 SSF54695, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 5 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9BSF8-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAGRPHPYDG NSSDPENWDR KLHSRPRKLY KHSSTSSRIA KGGVDHTKMS
60 70 80 90 100
LHGASGGHER SRDRRRSSDR SRDSSHERTE SQLTPCIRNV TSPTRQHHVE
110 120 130 140 150
REKDHSSSRP SSPRPQKASP NGSISSAGNS SRNSSQSSSD GSCKTAGEMV
160 170 180 190 200
FVYENAKEGA RNIRTSERVT LIVDNTRFVV DPSIFTAQPN TMLGRMFGSG
210 220 230 240 250
REHNFTRPNE KGEYEVAEGI GSTVFRAILD YYKTGIIRCP DGISIPELRE
260 270 280 290 300
ACDYLCISFE YSTIKCRDLS ALMHELSNDG ARRQFEFYLE EMILPLMVAS
310 320 330 340 350
AQSGERECHI VVLTDDDVVD WDEEYPPQMG EEYSQIIYST KLYRFFKYIE
360 370 380 390 400
NRDVAKSVLK ERGLKKIRLG IEGYPTYKEK VKKRPGGRPE VIYNYVQRPF
410 420 430 440 450
IRMSWEKEEG KSRHVDFQCV KSKSITNLAA AAADIPQDQL VVMHPTPQVD
460 470
ELDILPIHPP SGNSDLDPDA QNPML
Length:475
Mass (Da):53,779
Last modified:November 23, 2004 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i0D6433891EAA33A6
GO
Isoform 2 (identifier: Q9BSF8-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-33: MAGRPHPYDGNSSDPENWDRKLHSRPRKLYKHS → MPKDADLAFSASLFERAESLYTLISKFFSCFCVSTLAYTKG

Show »
Length:483
Mass (Da):54,406
Checksum:i60A410E3A24EDA6D
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 5 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
B7Z503B7Z503_HUMAN
BTB (POZ) domain containing 10, iso...
BTBD10 hCG_23555
427Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9PKU9E9PKU9_HUMAN
BTB/POZ domain-containing protein 1...
BTBD10
202Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9PPD8E9PPD8_HUMAN
BTB/POZ domain-containing protein 1...
BTBD10
66Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9PKM7E9PKM7_HUMAN
BTB/POZ domain-containing protein 1...
BTBD10
64Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9PN21E9PN21_HUMAN
BTB/POZ domain-containing protein 1...
BTBD10
36Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_033638145T → A. Corresponds to variant dbSNP:rs34185489Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0555521 – 33MAGRP…LYKHS → MPKDADLAFSASLFERAESL YTLISKFFSCFCVSTLAYTK G in isoform 2. 1 PublicationAdd BLAST33

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AY221959 mRNA Translation: AAO64360.1
AK294259 mRNA Translation: BAH11714.1
AK316163 mRNA Translation: BAH14534.1
AL832981 mRNA Translation: CAH56329.1
AC016884 Genomic DNA No translation available.
AC021269 Genomic DNA No translation available.
BC005071 mRNA Translation: AAH05071.2

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS73261.1 [Q9BSF8-2]
CCDS7811.1 [Q9BSF8-1]

NCBI Reference Sequences

More...
RefSeqi
NP_001284671.1, NM_001297742.1 [Q9BSF8-2]
NP_115696.2, NM_032320.6 [Q9BSF8-1]
XP_016873897.1, XM_017018408.1

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000278174; ENSP00000278174; ENSG00000148925 [Q9BSF8-1]
ENST00000530907; ENSP00000431186; ENSG00000148925 [Q9BSF8-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
84280

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:84280

UCSC genome browser

More...
UCSCi
uc001mkz.4 human [Q9BSF8-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY221959 mRNA Translation: AAO64360.1
AK294259 mRNA Translation: BAH11714.1
AK316163 mRNA Translation: BAH14534.1
AL832981 mRNA Translation: CAH56329.1
AC016884 Genomic DNA No translation available.
AC021269 Genomic DNA No translation available.
BC005071 mRNA Translation: AAH05071.2
CCDSiCCDS73261.1 [Q9BSF8-2]
CCDS7811.1 [Q9BSF8-1]
RefSeqiNP_001284671.1, NM_001297742.1 [Q9BSF8-2]
NP_115696.2, NM_032320.6 [Q9BSF8-1]
XP_016873897.1, XM_017018408.1

3D structure databases

Database of comparative protein structure models

More...
ModBasei
Search...

SWISS-MODEL Interactive Workspace

More...
SWISS-MODEL-Workspacei
Submit a new modelling project...

Protein-protein interaction databases

BioGRIDi124007, 14 interactors
IntActiQ9BSF8, 11 interactors
MINTiQ9BSF8
STRINGi9606.ENSP00000431186

PTM databases

iPTMnetiQ9BSF8
PhosphoSitePlusiQ9BSF8

Polymorphism and mutation databases

BioMutaiBTBD10
DMDMi74733002

Proteomic databases

EPDiQ9BSF8
jPOSTiQ9BSF8
MassIVEiQ9BSF8
MaxQBiQ9BSF8
PaxDbiQ9BSF8
PeptideAtlasiQ9BSF8
PRIDEiQ9BSF8
ProteomicsDBi6400
78886 [Q9BSF8-1]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
24598 206 antibodies

The DNASU plasmid repository

More...
DNASUi
84280

Genome annotation databases

EnsembliENST00000278174; ENSP00000278174; ENSG00000148925 [Q9BSF8-1]
ENST00000530907; ENSP00000431186; ENSG00000148925 [Q9BSF8-2]
GeneIDi84280
KEGGihsa:84280
UCSCiuc001mkz.4 human [Q9BSF8-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
84280
DisGeNETi84280
EuPathDBiHostDB:ENSG00000148925.10

GeneCards: human genes, protein and diseases

More...
GeneCardsi
BTBD10
HGNCiHGNC:21445 BTBD10
HPAiENSG00000148925 Low tissue specificity
MIMi615933 gene
neXtProtiNX_Q9BSF8
OpenTargetsiENSG00000148925
PharmGKBiPA142672543

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG3840 Eukaryota
ENOG410XSS5 LUCA
GeneTreeiENSGT00390000007975
InParanoidiQ9BSF8
KOiK10482
OMAiWDRKLHN
OrthoDBi390051at2759
PhylomeDBiQ9BSF8
TreeFamiTF314369

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
84280 2 hits in 786 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
BTBD10 human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
84280
PharosiQ9BSF8 Tbio

Protein Ontology

More...
PROi
PR:Q9BSF8
RNActiQ9BSF8 protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000148925 Expressed in corpus callosum and 204 other tissues
ExpressionAtlasiQ9BSF8 baseline and differential
GenevisibleiQ9BSF8 HS

Family and domain databases

InterProiView protein in InterPro
IPR000210 BTB/POZ_dom
IPR039886 BTBD10/KCTD20
IPR039885 BTBD10/KCTD20_BTB/POZ
IPR011333 SKP1/BTB/POZ_sf
PANTHERiPTHR21637 PTHR21637, 1 hit
PfamiView protein in Pfam
PF16017 BTB_3, 1 hit
SMARTiView protein in SMART
SM00225 BTB, 1 hit
SUPFAMiSSF54695 SSF54695, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiBTBDA_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9BSF8
Secondary accession number(s): B7Z228, Q86WG1
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: March 21, 2006
Last sequence update: November 23, 2004
Last modified: June 17, 2020
This is version 143 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Human chromosome 11
    Human chromosome 11: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again