UniProtKB - Q9BSB4 (ATGA1_HUMAN)

BLAST

>sp|Q9BSB4|ATGA1_HUMAN Autophagy-related protein 101 OS=Homo sapiens OX=9606 GN=ATG101 PE=1 SV=1
MNCRSEVLEVSVEGRQVEEAMLAVLHTVLLHRSTGKFHYKKEGTYSIGTVGTQDVDCDFI
DFTYVRVSSEELDRALRKVVGEFKDALRNSGGDGLGQMSLEFYQKKKSRWPFSDECIPWE
VWTVKVHVVALATEQERQICREKVGEKLCEKIINIVEVMNRHEYLPKMPTQSEVDNVFDT
GLRDVQPYLYKISFQITDALGTSVTTTMRRLIKDTLAL

Align
Format
Add to basket Added to basket
History
Entry version 126 (07 Nov 2018)
Sequence version 1 (01 Jun 2001)
Previous versions | rss
Other tutorials and videos
Help video
Feedback

Protein

Autophagy-related protein 101

Gene

ATG101

Organism

Homo sapiens (Human)

Status

Reviewed-Annotation score: -Experimental evidence at protein levelⁱ

Functionⁱ

Autophagy factor required for autophagosome formation. Stabilizes ATG13, protecting it from proteasomal degradation.2 Publications

GO - Molecular functionⁱ

identical protein binding
Source: IntAct
Inferred from physical interactionⁱ
- 20562859
protein-containing complex binding
Source: UniProtKB
Inferred from physical interactionⁱ
- 19597335

View the complete GO annotation on QuickGO ...

GO - Biological processⁱ

autophagosome assembly
Source: UniProtKB
Inferred from mutant phenotypeⁱ
- 19597335
macroautophagy Source: Reactome
regulation of macroautophagy Source: Reactome

View the complete GO annotation on QuickGO ...

Keywordsⁱ

Biological process	Autophagy

Biological process

Autophagy

Enzyme and pathway databases

Reactomeⁱ	R-HSA-1632852 Macroautophagy
SIGNORⁱ	Q9BSB4

Protein family/group databases

TCDBⁱ	9.A.15.2.1 the autophagy-related phagophore-formation transporter (apt) family

TCDBⁱ

9.A.15.2.1 the autophagy-related phagophore-formation transporter (apt) family

Names & Taxonomyⁱ

Protein namesⁱ	Recommended name: Autophagy-related protein 101
Gene namesⁱ	Name:ATG101 Synonyms:C12orf44 ORF Names:PP894
Organismⁱ	Homo sapiens (Human)
Taxonomic identifierⁱ	9606 [NCBI]
Taxonomic lineageⁱ	cellular organisms › Eukaryota › Opisthokonta › Metazoa › Eumetazoa › Bilateria › Deuterostomia › Chordata › Craniata › Vertebrata › Gnathostomata › Teleostomi › Euteleostomi › Sarcopterygii › Dipnotetrapodomorpha › Tetrapoda › Amniota › Mammalia › Theria › Eutheria › Boreoeutheria › Euarchontoglires › Primates › Haplorrhini › Simiiformes › Catarrhini › Hominoidea › Hominidae › Homininae › Homo
Proteomesⁱ	UP000005640 Componentⁱ: Chromosome 12

Organism-specific databases

EuPathDBⁱ	HostDB:ENSG00000123395.14
Human Gene Nomenclature Database More...HGNCⁱ	HGNC:25679 ATG101
MIMⁱ	615089 gene
neXtProtⁱ	NX_Q9BSB4

Keywords - Cellular componentⁱ

Cytoplasm

Pathology & Biotechⁱ

Mutagenesis

Feature key	Position(s)	DescriptionActions	Length
Mutagenesisⁱ	31	H → S: Impairs interaction with ATG13; when associated with R-54. 1 Publication	1
Mutagenesisⁱ	54	D → R: Impairs interaction with ATG13; when associated with S-31. 1 Publication	1
Mutagenesisⁱ	152	I → D: Abolishes interaction with ATG13; when associated with D-153 and D-156. 1 Publication	1
Mutagenesisⁱ	153	I → D: Abolishes interaction with ATG13; when associated with D-152 and D-156. 1 Publication	1
Mutagenesisⁱ	156	V → D: Abolishes interaction with ATG13; when associated with D-152 and D-152. 1 Publication	1

Organism-specific databases

Open Targets More...OpenTargetsⁱ	ENSG00000123395
PharmGKBⁱ	PA143485374

Polymorphism and mutation databases

BioMutaⁱ	ATG101
DMDMⁱ	74732983

PTM / Processingⁱ

Molecule processing

Feature key	Position(s)	DescriptionActions	Graphical view	Length
ChainⁱPRO_0000294322	1 – 218	Autophagy-related protein 101Add BLAST		218

Proteomic databases

EPDⁱ	Q9BSB4
MaxQB - The MaxQuant DataBase More...MaxQBⁱ	Q9BSB4
PaxDbⁱ	Q9BSB4
PeptideAtlas More...PeptideAtlasⁱ	Q9BSB4
PRIDEⁱ	Q9BSB4
ProteomicsDBⁱ	78873

PTM databases

iPTMnetⁱ	Q9BSB4
PhosphoSitePlusⁱ	Q9BSB4

Expressionⁱ

Gene expression databases

Bgeeⁱ	ENSG00000123395 Expressed in 219 organ(s), highest expression level in testis
CleanExⁱ	HS_C12orf44
ExpressionAtlasⁱ	Q9BSB4 baseline and differential
Genevisibleⁱ	Q9BSB4 HS

Organism-specific databases

Human Protein Atlas More...HPAⁱ	HPA039904

HPAⁱ

HPA039904

Interactionⁱ

Subunit structureⁱ

Interacts with ATG13 (PubMed:19287211, PubMed:19597335, PubMed:26299944). Associates with a complex composed of ATG13, ULK1 and RB1CC1; the association with this complex requires the presence of ATG13 (PubMed:19287211, PubMed:19597335).3 Publications

Binary interactionsⁱ

With	Entry	#Exp.	IntAct	Notes
itself		2	EBI-2946739,EBI-2946739
ATG13	O75143	16	EBI-2946739,EBI-2798775
Atg13	Q91YI1	2	EBI-2946739,EBI-8391007	From Mus musculus.
MAP1LC3C	Q9BXW4	3	EBI-2946739,EBI-2603996
RB1CC1	Q8TDY2	7	EBI-2946739,EBI-1047793

GO - Molecular functionⁱ

identical protein binding
Source: IntAct
Inferred from physical interactionⁱ
- 20562859

View the complete GO annotation on QuickGO ...

Protein-protein interaction databases

BioGridⁱ	121948, 51 interactors
ComplexPortalⁱ	CPX-373 ULK1-ATG13-RB1CC1-ATG101 autophagy initiation complex
CORUMⁱ	Q9BSB4
Database of interacting proteins More...DIPⁱ	DIP-60653N
IntActⁱ	Q9BSB4, 43 interactors
Molecular INTeraction database More...MINTⁱ	Q9BSB4
STRINGⁱ	9606.ENSP00000338990

Structureⁱ

Secondary structure

Legend: HelixTurnBeta strandPDB Structure known for this area

Feature key	Position(s)	DescriptionActions	Length
Beta strandⁱ	4 – 13	Combined sources	10
Helixⁱ	14 – 16	Combined sources	3
Helixⁱ	17 – 31	Combined sources	15
Beta strandⁱ	32 – 34	Combined sources	3
Beta strandⁱ	37 – 39	Combined sources	3
Helixⁱ	41 – 43	Combined sources	3
Beta strandⁱ	45 – 47	Combined sources	3
Beta strandⁱ	52 – 56	Combined sources	5
Beta strandⁱ	58 – 61	Combined sources	4
Beta strandⁱ	63 – 68	Combined sources	6
Helixⁱ	70 – 89	Combined sources	20
Beta strandⁱ	92 – 105	Combined sources	14
Beta strandⁱ	113 – 129	Combined sources	17
Helixⁱ	134 – 161	Combined sources	28
Helixⁱ	171 – 176	Combined sources	6
Beta strandⁱ	186 – 188	Combined sources	3
Beta strandⁱ	190 – 198	Combined sources	9
Beta strandⁱ	202 – 207	Combined sources	6
Helixⁱ	208 – 214	Combined sources	7

Show more details

3D structure databases

ProteinModelPortalⁱ	Q9BSB4
SMRⁱ	Q9BSB4
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Family & Domainsⁱ

Region

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Regionⁱ	152 – 156	Important for interaction with ATG131 Publication		5

Sequence similaritiesⁱ

Belongs to the ATG101 family.Curated

Phylogenomic databases

eggNOGⁱ	KOG4493 Eukaryota ENOG410XP6A LUCA
Ensembl GeneTree More...GeneTreeⁱ	ENSGT00390000016511
HOGENOMⁱ	HOG000008086
InParanoidⁱ	Q9BSB4
KEGG Orthology (KO) More...KOⁱ	K19730
OMAⁱ	IDCDFID
Database of Orthologous Groups More...OrthoDBⁱ	EOG091G076X
PhylomeDBⁱ	Q9BSB4
TreeFamⁱ	TF320996

Family and domain databases

InterProⁱ	View protein in InterPro IPR012445 ATG101
PANTHERⁱ	PTHR13292 PTHR13292, 1 hit
Pfam protein domain database More...Pfamⁱ	View protein in Pfam PF07855 ATG101, 1 hit

Sequence (1+)ⁱ

Sequence statusⁱ: Complete.

This entry has 1 described isoform and 3 potential isoforms that are computationally mapped.Show all Align All

Q9BSB4-1 [UniParc]FASTA Add to basket

« Hide

        10         20         30         40         50
MNCRSEVLEV SVEGRQVEEA MLAVLHTVLL HRSTGKFHYK KEGTYSIGTV 
        60         70         80         90        100
GTQDVDCDFI DFTYVRVSSE ELDRALRKVV GEFKDALRNS GGDGLGQMSL 
       110        120        130        140        150
EFYQKKKSRW PFSDECIPWE VWTVKVHVVA LATEQERQIC REKVGEKLCE 
       160        170        180        190        200
KIINIVEVMN RHEYLPKMPT QSEVDNVFDT GLRDVQPYLY KISFQITDAL 
       210 
GTSVTTTMRR LIKDTLAL

Length:218

Mass (Da):25,003

Last modified:June 1, 2001 - v1

Checksum:ⁱ69A881EAF9A07659

Computationally mapped potential isoform sequencesⁱ

There are 3 potential isoforms mapped to this entry.BLAST Align Show all Add to basket

Entry	Entry name	Protein names	Gene names	Length	Annotation

H3BMZ4	H3BMZ4_HUMAN	Autophagy-related protein 101 Autophagy-related protein 101	ATG101	84	Annotation score:
F8VQD9	F8VQD9_HUMAN	Autophagy-related protein 101 Autophagy-related protein 101	ATG101	190	Annotation score:
F8VVA0	F8VVA0_HUMAN	Autophagy-related protein 101 Autophagy-related protein 101	ATG101	141	Annotation score:

Sequence cautionⁱ

The sequence AAG17273 differs from that shown. Reason: Frameshift at position 110.Curated

Experimental Info

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Sequence conflictⁱ	47	I → T in BAB13907 (PubMed:14702039).Curated		1

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	AK021835 mRNA Translation: BAB13907.1 AF218031 mRNA Translation: AAG17273.1 Frameshift. AC025259 Genomic DNA No translation available. BC005151 mRNA Translation: AAH05151.1 BC009937 mRNA Translation: AAH09937.1
The Consensus CDS (CCDS) project More...CCDSⁱ	CCDS8820.1
NCBI Reference Sequences More...RefSeqⁱ	NP_001092143.1, NM_001098673.1 NP_068753.2, NM_021934.4
UniGeneⁱ	Hs.9911

Genome annotation databases

Ensemblⁱ	ENST00000336854; ENSP00000338990; ENSG00000123395
GeneIDⁱ	60673
KEGGⁱ	hsa:60673
UCSC genome browser More...UCSCⁱ	uc001rzu.5 human

Similar proteinsⁱ

100% Identity
90% Identity
50% Identity

Protein	Similar proteins		Species	Score	Length	Source
Q9BSB4	Chromosome 12 open reading frame 44, isoform CRA_a		HUMAN		218	UniRef100_Q9BSB4
Autophagy related 101		MACMU		218
ATG101 isoform 1		PANTR		218
Autophagy related 101		GORGO		218
Autophagy related 101		MACNE		218
+28

Protein	Similar proteins		Species	Score	Length	Source
Q9BSB4	Chromosome 12 open reading frame 44, isoform CRA_a		HUMAN		218	UniRef90_Q9BSB4
Autophagy related 101		MACMU		218
ATG101 isoform 1		PANTR		218
Autophagy related 101		GORGO		218
Autophagy related 101		MACNE		218
+28

Protein	Similar proteins		Species	Score	Length	Source
Q9BSB4	Chromosome 12 open reading frame 44, isoform CRA_a		HUMAN		218	UniRef50_Q9BSB4
Autophagy related 101		MACMU		218
ATG101 isoform 1		PANTR		218
Autophagy related 101		GORGO		218
Autophagy related 101		MACNE		218
+52

Cross-referencesⁱ

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	AK021835 mRNA Translation: BAB13907.1 AF218031 mRNA Translation: AAG17273.1 Frameshift. AC025259 Genomic DNA No translation available. BC005151 mRNA Translation: AAH05151.1 BC009937 mRNA Translation: AAH09937.1
CCDSⁱ	CCDS8820.1
RefSeqⁱ	NP_001092143.1, NM_001098673.1 NP_068753.2, NM_021934.4
UniGeneⁱ	Hs.9911

3D structure databases

Select the link destinations: Protein Data Bank Europe More...PDBeⁱ Protein Data Bank RCSB More...RCSB PDBⁱ Protein Data Bank Japan More...PDBjⁱ Links Updated	PDB entry	Method	Resolution (Å)	Chain	Positions	PDBsum
	4WZG	X-ray	1.90	A	1-218	[»]
	5C50	X-ray	1.63	A	1-198	[»]
	5XUY	X-ray	2.20	B/D	1-218	[»]
	5XV1	X-ray	2.51	B/D	1-218	[»]
	5XV3	X-ray	2.57	B/D	1-218	[»]
	5XV4	X-ray	2.95	B/D/F/H/J/L/N/P	1-218	[»]
	5XV6	X-ray	2.46	B	1-218	[»]
ProteinModelPortalⁱ	Q9BSB4
SMRⁱ	Q9BSB4
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Protein-protein interaction databases

BioGridⁱ	121948, 51 interactors
ComplexPortalⁱ	CPX-373 ULK1-ATG13-RB1CC1-ATG101 autophagy initiation complex
CORUMⁱ	Q9BSB4
DIPⁱ	DIP-60653N
IntActⁱ	Q9BSB4, 43 interactors
MINTⁱ	Q9BSB4
STRINGⁱ	9606.ENSP00000338990

Protein family/group databases

TCDBⁱ	9.A.15.2.1 the autophagy-related phagophore-formation transporter (apt) family

TCDBⁱ

9.A.15.2.1 the autophagy-related phagophore-formation transporter (apt) family

PTM databases

iPTMnetⁱ	Q9BSB4
PhosphoSitePlusⁱ	Q9BSB4

Polymorphism and mutation databases

BioMutaⁱ	ATG101
DMDMⁱ	74732983

Proteomic databases

EPDⁱ	Q9BSB4
MaxQBⁱ	Q9BSB4
PaxDbⁱ	Q9BSB4
PeptideAtlasⁱ	Q9BSB4
PRIDEⁱ	Q9BSB4
ProteomicsDBⁱ	78873

Protocols and materials databases

The DNASU plasmid repository More...DNASUⁱ	60673
Structural Biology Knowledgebase	Search...

Genome annotation databases

Ensemblⁱ	ENST00000336854; ENSP00000338990; ENSG00000123395
GeneIDⁱ	60673
KEGGⁱ	hsa:60673
UCSCⁱ	uc001rzu.5 human

Organism-specific databases

CTDⁱ	60673
EuPathDBⁱ	HostDB:ENSG00000123395.14
GeneCardsⁱ	ATG101
H-InvDBⁱ	HIX0010645
HGNCⁱ	HGNC:25679 ATG101
HPAⁱ	HPA039904
MIMⁱ	615089 gene
neXtProtⁱ	NX_Q9BSB4
OpenTargetsⁱ	ENSG00000123395
PharmGKBⁱ	PA143485374
GenAtlas: human gene database More...GenAtlasⁱ	Search...

Phylogenomic databases

eggNOGⁱ	KOG4493 Eukaryota ENOG410XP6A LUCA
GeneTreeⁱ	ENSGT00390000016511
HOGENOMⁱ	HOG000008086
InParanoidⁱ	Q9BSB4
KOⁱ	K19730
OMAⁱ	IDCDFID
OrthoDBⁱ	EOG091G076X
PhylomeDBⁱ	Q9BSB4
TreeFamⁱ	TF320996

Enzyme and pathway databases

Reactomeⁱ	R-HSA-1632852 Macroautophagy
SIGNORⁱ	Q9BSB4

Miscellaneous databases

GeneWikiⁱ	Autophagy-related_protein_101
GenomeRNAiⁱ	60673
Protein Ontology More...PROⁱ	PR:Q9BSB4
SOURCEⁱ	Search...

Gene expression databases

Bgeeⁱ	ENSG00000123395 Expressed in 219 organ(s), highest expression level in testis
CleanExⁱ	HS_C12orf44
ExpressionAtlasⁱ	Q9BSB4 baseline and differential
Genevisibleⁱ	Q9BSB4 HS

Family and domain databases

InterProⁱ	View protein in InterPro IPR012445 ATG101
PANTHERⁱ	PTHR13292 PTHR13292, 1 hit
Pfamⁱ	View protein in Pfam PF07855 ATG101, 1 hit
ProtoNetⁱ	Search...

Entry informationⁱ

Entry nameⁱ	ATGA1_HUMAN
Accessionⁱ	Q9BSB4Primary (citable) accession number: Q9BSB4 Secondary accession number(s): Q9HAE2, Q9HBN1
Entry historyⁱ	Integrated into UniProtKB/Swiss-Prot:	July 10, 2007
	Last sequence update:	June 1, 2001
	Last modified:	November 7, 2018
	This is version 126 of the entry and version 1 of the sequence. See complete history.
Entry statusⁱ	Reviewed (UniProtKB/Swiss-Prot)
Annotation program	Chordata Protein Annotation Program
Disclaimer	Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousⁱ

Keywords - Technical termⁱ

3D-structure, Complete proteome, Reference proteome

Documents

SIMILARITY comments
Index of protein domains and families
MIM cross-references
Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
Uncharacterized protein families (UPF)
List of uncharacterized protein family (UPF) entries
PDB cross-references
Index of Protein Data Bank (PDB) cross-references
Human chromosome 12
Human chromosome 12: entries, gene names and cross-references to MIM

UniProtKB

UniParc

Help

UniRef

Proteomes

Annotation systems

Supporting data

UniProtKB - Q9BSB4 (ATGA1_HUMAN)

Your basket is currently empty. i <p>When browsing through different UniProt proteins, you can use the ‘basket’ to save them, so that you can back to find or analyse them later.<p><a href='/help/basket' target='_top'>More...</a></p>

Autophagy-related protein 101

ATG101

Select a section on the left to see content.

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

Enzyme and pathway databases

Protein family/group databases

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

Organism-specific databases

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Other locations

Cytosol

Endoplasmic reticulum

Other locations

Keywords - Cellular componenti

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Organism-specific databases

Polymorphism and mutation databases

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Proteomic databases

PTM databases

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Organism-specific databases

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

GO - Molecular functioni

Protein-protein interaction databases

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

3D structure databases

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Region

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Phylogenomic databases

Family and domain databases

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

Experimental Info

Sequence databases

Genome annotation databases

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

3D structure databases

Protein-protein interaction databases

Protein family/group databases

PTM databases

Polymorphism and mutation databases

Proteomic databases

Protocols and materials databases

Genome annotation databases

Organism-specific databases

Phylogenomic databases

Enzyme and pathway databases

Miscellaneous databases

Gene expression databases

Family and domain databases

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Documents

UniProt is an ELIXIR core data resource

Your basket is currently empty. ⁱ

Functionⁱ

GO - Molecular functionⁱ

GO - Biological processⁱ

Names & Taxonomyⁱ

Subcellular locationⁱ

Keywords - Cellular componentⁱ

Pathology & Biotechⁱ

PTM / Processingⁱ

Expressionⁱ

Interactionⁱ

GO - Molecular functionⁱ

Structureⁱ

Family & Domainsⁱ

Sequence similaritiesⁱ

Sequence cautionⁱ

Cross-referencesⁱ

Entry informationⁱ

Miscellaneousⁱ

Keywords - Technical termⁱ