Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 154 (31 Jul 2019)
Sequence version 3 (21 Dec 2004)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

E3 ubiquitin-protein ligase TRIM56

Gene

TRIM56

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

E3 ubiquitin-protein ligase that plays a key role in innate antiviral immunity (PubMed:21289118). In response to pathogen- and host-derived double-stranded DNA (dsDNA), targets TMEM173/STING to 'Lys-63'-linked ubiquitination, thereby promoting its homodimerization, a step required for the production of type I interferon IFN-beta (By similarity). Independently of its E3 ubiquitin ligase activity, positive regulator of TLR3 signaling. Potentiates extracellular double stranded RNA (dsRNA)-induced expression of IFNB1 and interferon-stimulated genes ISG15, IFIT1/ISG56, CXCL10, OASL and CCL5/RANTES. Promotes establishment of an antiviral state by TLR3 ligand and TLR3-mediated chemokine induction following infection by hepatitis C virus (PubMed:22948160).By similarity2 Publications

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

  • S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine. EC:2.3.2.27

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section specifies the position(s) and type(s) of zinc fingers within the protein.<p><a href='/help/zn_fing' target='_top'>More...</a></p>Zinc fingeri21 – 60RING-typePROSITE-ProRule annotationAdd BLAST40
Zinc fingeri98 – 149B box-type 1PROSITE-ProRule annotationAdd BLAST52
Zinc fingeri164 – 205B box-type 2PROSITE-ProRule annotationAdd BLAST42

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionTransferase
Biological processAntiviral defense, Immunity, Innate immunity, Ubl conjugation pathway
LigandMetal-binding, Zinc

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-3134975 Regulation of innate immune responses to cytosolic DNA

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
E3 ubiquitin-protein ligase TRIM56 (EC:2.3.2.27)
Alternative name(s):
RING finger protein 109
RING-type E3 ubiquitin transferase TRIM56Curated
Tripartite motif-containing protein 56
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:TRIM56
Synonyms:RNF109
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 7

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:19028 TRIM56

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
616996 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q9BRZ2

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi21C → A: Complete loss of autoubiquitination. Complete loss of autoubiquitination, loss of antiviral activity against yellow fever virus and human coronavirus virus OC43, but normal induction of interferon-beta following Sendai virus infection; when associated with A-24. 1 Publication1
Mutagenesisi24C → A: Complete loss of autoubiquitination, loss of antiviral activity against yellow fever virus and human coronavirus virus OC43, but normal induction of interferon-beta following Sendia virus infection; when associated with A-24. 1 Publication1

Organism-specific databases

DisGeNET

More...
DisGeNETi
81844

Open Targets

More...
OpenTargetsi
ENSG00000169871

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA134958549

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
TRIM56

Domain mapping of disease mutations (DMDM)

More...
DMDMi
56749788

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000562881 – 755E3 ubiquitin-protein ligase TRIM56Add BLAST755

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei418PhosphothreonineCombined sources1
Modified residuei442PhosphothreonineCombined sources1
Modified residuei475PhosphoserineCombined sources1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Autoubiquitinated.1 Publication

Keywords - PTMi

Phosphoprotein, Ubl conjugation

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q9BRZ2

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q9BRZ2

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q9BRZ2

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9BRZ2

PeptideAtlas

More...
PeptideAtlasi
Q9BRZ2

PRoteomics IDEntifications database

More...
PRIDEi
Q9BRZ2

ProteomicsDB human proteome resource

More...
ProteomicsDBi
78854 [Q9BRZ2-1]
78855 [Q9BRZ2-2]
78856 [Q9BRZ2-3]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9BRZ2

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9BRZ2

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Widely expressed (at protein level).1 Publication

<p>This subsection of the ‘Expression’ section reports the experimentally proven effects of inducers and repressors (usually chemical compounds or environmental factors) on the level of protein (or mRNA) expression (up-regulation, down-regulation, constitutive expression).<p><a href='/help/induction' target='_top'>More...</a></p>Inductioni

Up-regulated by IFN-alpha.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000169871 Expressed in 216 organ(s), highest expression level in tendon of biceps brachii

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q9BRZ2 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9BRZ2 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA024358

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Homooligomer.

Interacts with TMEM173/STING (By similarity).

Interacts with TICAM1 (PubMed:22948160).

By similarity1 Publication

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
123596, 32 interactors

Protein interaction database and analysis system

More...
IntActi
Q9BRZ2, 20 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000305161

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1755
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q9BRZ2

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and domains’ section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili216 – 314Sequence analysisAdd BLAST99

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi302 – 309Poly-Ala8
Compositional biasi459 – 464Poly-Lys6

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the TRIM/RBCC family.Curated

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri21 – 60RING-typePROSITE-ProRule annotationAdd BLAST40
Zinc fingeri98 – 149B box-type 1PROSITE-ProRule annotationAdd BLAST52
Zinc fingeri164 – 205B box-type 2PROSITE-ProRule annotationAdd BLAST42

Keywords - Domaini

Coiled coil, Repeat, Zinc-finger

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410ITEJ Eukaryota
ENOG410YNG0 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000162489

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000154679

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9BRZ2

KEGG Orthology (KO)

More...
KOi
K12026

Identification of Orthologs from Complete Genome Data

More...
OMAi
PRPIFSC

Database of Orthologous Groups

More...
OrthoDBi
489543at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9BRZ2

TreeFam database of animal gene trees

More...
TreeFami
TF338323

Family and domain databases

Conserved Domains Database

More...
CDDi
cd00021 BBOX, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
2.120.10.30, 1 hit
3.30.40.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR011042 6-blade_b-propeller_TolB-like
IPR027370 Znf-RING_LisH
IPR000315 Znf_B-box
IPR001841 Znf_RING
IPR013083 Znf_RING/FYVE/PHD
IPR017907 Znf_RING_CS

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00643 zf-B_box, 1 hit
PF13445 zf-RING_UBOX, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00336 BBOX, 1 hit
SM00184 RING, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50119 ZF_BBOX, 1 hit
PS00518 ZF_RING_1, 1 hit
PS50089 ZF_RING_2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9BRZ2-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MVSHGSSPSL LEALSSDFLA CKICLEQLRA PKTLPCLHTY CQDCLAQLAD
60 70 80 90 100
GGRVRCPECR ETVPVPPEGV ASFKTNFFVN GLLDLVKARA CGDLRAGKPA
110 120 130 140 150
CALCPLVGGT STGGPATARC LDCADDLCQA CADGHRCTRQ THTHRVVDLV
160 170 180 190 200
GYRAGWYDEE ARERQAAQCP QHPGEALRFL CQPCSQLLCR ECRLDPHLDH
210 220 230 240 250
PCLPLAEAVR ARRPGLEGLL AGVDNNLVEL EAARRVEKEA LARLREQAAR
260 270 280 290 300
VGTQVEEAAE GVLRALLAQK QEVLGQLRAH VEAAEEAARE RLAELEGREQ
310 320 330 340 350
VARAAAAFAR RVLSLGREAE ILSLEGAIAQ RLRQLQGCPW APGPAPCLLP
360 370 380 390 400
QLELHPGLLD KNCHLLRLSF EEQQPQKDGG KDGAGTQGGE ESQSRREDEP
410 420 430 440 450
KTERQGGVQP QAGDGAQTPK EEKAQTTREE GAQTLEEDRA QTPHEDGGPQ
460 470 480 490 500
PHRGGRPNKK KKFKGRLKSI SREPSPALGP NLDGSGLLPR PIFYCSFPTR
510 520 530 540 550
MPGDKRSPRI TGLCPFGPRE ILVADEQNRA LKRFSLNGDY KGTVPVPEGC
560 570 580 590 600
SPCSVAALQS AVAFSASARL YLINPNGEVQ WRRALSLSQA SHAVAALPSG
610 620 630 640 650
DRVAVSVAGH VEVYNMEGSL ATRFIPGGKA SRGLRALVFL TTSPQGHFVG
660 670 680 690 700
SDWQQNSVVI CDGLGQVVGE YKGPGLHGCQ PGSVSVDKKG YIFLTLREVN
710 720 730 740 750
KVVILDPKGS LLGDFLTAYH GLEKPRVTTM VDGRYLVVSL SNGTIHIFRV

RSPDS
Length:755
Mass (Da):81,488
Last modified:December 21, 2004 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iCF72D0C8EC9F69E7
GO
Isoform 2 (identifier: Q9BRZ2-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     273-308: VLGQLRAHVEAAEEAARERLAELEGREQVARAAAAF → NHLNPGGGSCSELRSHHCTPAWVTRMKLHLKKKKKK
     309-755: Missing.

Note: No experimental confirmation available.
Show »
Length:308
Mass (Da):33,550
Checksum:iEB69C6B0CE90A126
GO
Isoform 3 (identifier: Q9BRZ2-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     259-269: AEGVLRALLAQ → CLLRTESCKAE
     270-755: Missing.

Show »
Length:269
Mass (Da):29,185
Checksum:iCA973592F7F41BB4
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
C9JI91C9JI91_HUMAN
E3 ubiquitin-protein ligase TRIM56
TRIM56
305Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0D9SF19A0A0D9SF19_HUMAN
E3 ubiquitin-protein ligase TRIM56
TRIM56
65Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAH11882 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated
The sequence BAC11500 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti230L → P in AK092927 (PubMed:14702039).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_029109259 – 269AEGVLRALLAQ → CLLRTESCKAE in isoform 3. 1 PublicationAdd BLAST11
Alternative sequenceiVSP_029110270 – 755Missing in isoform 3. 1 PublicationAdd BLAST486
Alternative sequenceiVSP_029111273 – 308VLGQL…AAAAF → NHLNPGGGSCSELRSHHCTP AWVTRMKLHLKKKKKK in isoform 2. 1 PublicationAdd BLAST36
Alternative sequenceiVSP_029112309 – 755Missing in isoform 2. 1 PublicationAdd BLAST447

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AK075255 mRNA Translation: BAC11500.1 Different initiation.
AK092927 mRNA No translation available.
AC105446 Genomic DNA No translation available.
BC005847 mRNA Translation: AAH05847.3
BC011882 mRNA Translation: AAH11882.1 Different initiation.
BC048194 mRNA Translation: AAH48194.1
AL512757 mRNA Translation: CAC21676.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS43625.1 [Q9BRZ2-1]

NCBI Reference Sequences

More...
RefSeqi
NP_112223.1, NM_030961.2 [Q9BRZ2-1]
XP_011514891.1, XM_011516589.2 [Q9BRZ2-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000306085; ENSP00000305161; ENSG00000169871 [Q9BRZ2-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
81844

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:81844

UCSC genome browser

More...
UCSCi
uc003uxq.4 human [Q9BRZ2-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK075255 mRNA Translation: BAC11500.1 Different initiation.
AK092927 mRNA No translation available.
AC105446 Genomic DNA No translation available.
BC005847 mRNA Translation: AAH05847.3
BC011882 mRNA Translation: AAH11882.1 Different initiation.
BC048194 mRNA Translation: AAH48194.1
AL512757 mRNA Translation: CAC21676.1
CCDSiCCDS43625.1 [Q9BRZ2-1]
RefSeqiNP_112223.1, NM_030961.2 [Q9BRZ2-1]
XP_011514891.1, XM_011516589.2 [Q9BRZ2-1]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
5JW7X-ray2.85B1-93[»]
SMRiQ9BRZ2
ModBaseiSearch...

Protein-protein interaction databases

BioGridi123596, 32 interactors
IntActiQ9BRZ2, 20 interactors
STRINGi9606.ENSP00000305161

PTM databases

iPTMnetiQ9BRZ2
PhosphoSitePlusiQ9BRZ2

Polymorphism and mutation databases

BioMutaiTRIM56
DMDMi56749788

Proteomic databases

EPDiQ9BRZ2
jPOSTiQ9BRZ2
MaxQBiQ9BRZ2
PaxDbiQ9BRZ2
PeptideAtlasiQ9BRZ2
PRIDEiQ9BRZ2
ProteomicsDBi78854 [Q9BRZ2-1]
78855 [Q9BRZ2-2]
78856 [Q9BRZ2-3]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
81844
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000306085; ENSP00000305161; ENSG00000169871 [Q9BRZ2-1]
GeneIDi81844
KEGGihsa:81844
UCSCiuc003uxq.4 human [Q9BRZ2-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
81844
DisGeNETi81844

GeneCards: human genes, protein and diseases

More...
GeneCardsi
TRIM56
HGNCiHGNC:19028 TRIM56
HPAiHPA024358
MIMi616996 gene
neXtProtiNX_Q9BRZ2
OpenTargetsiENSG00000169871
PharmGKBiPA134958549

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG410ITEJ Eukaryota
ENOG410YNG0 LUCA
GeneTreeiENSGT00940000162489
HOGENOMiHOG000154679
InParanoidiQ9BRZ2
KOiK12026
OMAiPRPIFSC
OrthoDBi489543at2759
PhylomeDBiQ9BRZ2
TreeFamiTF338323

Enzyme and pathway databases

ReactomeiR-HSA-3134975 Regulation of innate immune responses to cytosolic DNA

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
TRIM56 human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
81844

Protein Ontology

More...
PROi
PR:Q9BRZ2

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000169871 Expressed in 216 organ(s), highest expression level in tendon of biceps brachii
ExpressionAtlasiQ9BRZ2 baseline and differential
GenevisibleiQ9BRZ2 HS

Family and domain databases

CDDicd00021 BBOX, 1 hit
Gene3Di2.120.10.30, 1 hit
3.30.40.10, 1 hit
InterProiView protein in InterPro
IPR011042 6-blade_b-propeller_TolB-like
IPR027370 Znf-RING_LisH
IPR000315 Znf_B-box
IPR001841 Znf_RING
IPR013083 Znf_RING/FYVE/PHD
IPR017907 Znf_RING_CS
PfamiView protein in Pfam
PF00643 zf-B_box, 1 hit
PF13445 zf-RING_UBOX, 1 hit
SMARTiView protein in SMART
SM00336 BBOX, 1 hit
SM00184 RING, 1 hit
PROSITEiView protein in PROSITE
PS50119 ZF_BBOX, 1 hit
PS00518 ZF_RING_1, 1 hit
PS50089 ZF_RING_2, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiTRI56_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9BRZ2
Secondary accession number(s): Q6PJS5
, Q86VT6, Q8N2H8, Q8NAC0, Q9H031
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: December 21, 2004
Last sequence update: December 21, 2004
Last modified: July 31, 2019
This is version 154 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. SIMILARITY comments
    Index of protein domains and families
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  4. Human chromosome 7
    Human chromosome 7: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again