Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - Q9BRY0 (S39A3_HUMAN)

Entry version 145 (02 Dec 2020)
Sequence version 2 (01 Mar 2004)
Previous versions | rss
Add a publicationFeedback
Protein

Zinc transporter ZIP3

Gene

SLC39A3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Acts as a zinc-influx transporter.Curated

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processIon transport, Transport, Zinc transport
LigandZinc

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		Q9BRY0

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-442380, Zinc influx into cells by the SLC39 gene family

Protein family/group databases

Transport Classification Database

More...TCDBi		2.A.5.3.3, the zinc (zn(2+))-iron (fe(2+)) permease (zip) family

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Zinc transporter ZIP3
Alternative name(s):
Solute carrier family 39 member 3
Zrt- and Irt-like protein 3
Short name:
ZIP-3
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:SLC39A3
Synonyms:ZIP3
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 19

Organism-specific databases

Eukaryotic Pathogen and Host Database Resources

More...EuPathDBi		HostDB:ENSG00000141873.10

Human Gene Nomenclature Database

More...HGNCi		HGNC:17128, SLC39A3

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		612168, gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_Q9BRY0

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini1 – 3ExtracellularSequence analysis3
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei4 – 24HelicalSequence analysisAdd BLAST21
Topological domaini25 – 42CytoplasmicSequence analysisAdd BLAST18
Transmembranei43 – 63HelicalSequence analysisAdd BLAST21
Topological domaini64 – 85ExtracellularSequence analysisAdd BLAST22
Transmembranei86 – 106HelicalSequence analysisAdd BLAST21
Topological domaini107 – 169CytoplasmicSequence analysisAdd BLAST63
Transmembranei170 – 190HelicalSequence analysisAdd BLAST21
Topological domaini191 – 196ExtracellularSequence analysis6
Transmembranei197 – 217HelicalSequence analysisAdd BLAST21
Topological domaini218 – 229CytoplasmicSequence analysisAdd BLAST12
Transmembranei230 – 250HelicalSequence analysisAdd BLAST21
Topological domaini251 – 262ExtracellularSequence analysisAdd BLAST12
Transmembranei263 – 283HelicalSequence analysisAdd BLAST21
Topological domaini284 – 292CytoplasmicSequence analysis9
Transmembranei293 – 313HelicalSequence analysisAdd BLAST21
Topological domaini314ExtracellularSequence analysis1

Keywords - Cellular componenti

Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...DisGeNETi		29985

Open Targets

More...OpenTargetsi		ENSG00000141873

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA38203

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		Q9BRY0, Tbio

Chemistry databases

Drug and drug target database

More...DrugBanki		DB14533, Zinc chloride
DB14548, Zinc sulfate, unspecified form

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		SLC39A3

Domain mapping of disease mutations (DMDM)

More...DMDMi		74732942

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003128681 – 314Zinc transporter ZIP3Add BLAST314

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei125PhosphoserineCombined sources1
Modified residuei129PhosphoserineBy similarity1

Keywords - PTMi

Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...EPDi		Q9BRY0

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		Q9BRY0

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		Q9BRY0

MaxQB - The MaxQuant DataBase

More...MaxQBi		Q9BRY0

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q9BRY0

PeptideAtlas

More...PeptideAtlasi		Q9BRY0

PRoteomics IDEntifications database

More...PRIDEi		Q9BRY0

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		78852 [Q9BRY0-1]
78853 [Q9BRY0-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q9BRY0

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q9BRY0

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000141873, Expressed in muscle tissue and 188 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		Q9BRY0, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q9BRY0, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000141873, Low tissue specificity

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		119011, 42 interactors

Protein interaction database and analysis system

More...IntActi		Q9BRY0, 8 interactors

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000269740

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		Q9BRY0, protein

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the ZIP transporter (TC 2.A.5) family. [View classification]Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG1558, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00940000160231

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_040462_4_1_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q9BRY0

Database of Orthologous Groups

More...OrthoDBi		981397at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q9BRY0

TreeFam database of animal gene trees

More...TreeFami		TF317098

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR003689, ZIP

Pfam protein domain database

More...Pfami		View protein in Pfam
PF02535, Zip, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9BRY0-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MVKLLVAKIL CMVGVFFFML LGSLLPVKII ETDFEKAHRS KKILSLCNTF 
        60         70         80         90        100
GGGVFLATCF NALLPAVREK LQKVLSLGHI STDYPLAETI LLLGFFMTVF 
       110        120        130        140        150
LEQLILTFRK EKPSFIDLET FNAGSDVGSD SEYESPFMGG ARGHALYVEP 
       160        170        180        190        200
HGHGPSLSVQ GLSRASPVRL LSLAFALSAH SVFEGLALGL QEEGEKVVSL 
       210        220        230        240        250
FVGVAVHETL VAVALGISMA RSAMPLRDAA KLAVTVSAMI PLGIGLGLGI 
       260        270        280        290        300
ESAQGVPGSV ASVLLQGLAG GTFLFITFLE ILAKELEEKS DRLLKVLFLV 
       310 
LGYTVLAGMV FLKW
Length:314
Mass (Da):33,601
Last modified:March 1, 2004 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i572ADE958735D2CE
GO
Isoform 2 (identifier: Q9BRY0-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     71-105: LQKVLSLGHISTDYPLAETILLLGFFMTVFLEQLI → VRAPWALAAALGTLWPRDSDAFSTLMPSSVKALML
     106-314: Missing.

Show »
Length:105
Mass (Da):11,459
Checksum:i23AB373A99F177F7
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
F5H385F5H385_HUMAN
Zinc transporter ZIP3
SLC39A3
323Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
K7EJZ1K7EJZ1_HUMAN
Zinc transporter ZIP3
SLC39A3
136Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
K7ENJ1K7ENJ1_HUMAN
Zinc transporter ZIP3
SLC39A3
107Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_037599100F → L. Corresponds to variant dbSNP:rs11539244Ensembl.1
Natural variantiVAR_037600257P → L. Corresponds to variant dbSNP:rs35594294Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_02992071 – 105LQKVL…LEQLI → VRAPWALAAALGTLWPRDSD AFSTLMPSSVKALML in isoform 2. 2 PublicationsAdd BLAST35
Alternative sequenceiVSP_029921106 – 314Missing in isoform 2. 2 PublicationsAdd BLAST209

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AK002044 mRNA Translation: BAG51005.1
BC005869 mRNA Translation: AAH05869.2
BC020571 mRNA Translation: AAH20571.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS12093.1 [Q9BRY0-1]
CCDS45909.1 [Q9BRY0-2]

NCBI Reference Sequences

More...RefSeqi		NP_653165.2, NM_144564.4 [Q9BRY0-1]
NP_998733.1, NM_213568.1 [Q9BRY0-2]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000269740; ENSP00000269740; ENSG00000141873 [Q9BRY0-1]
ENST00000455372; ENSP00000393715; ENSG00000141873 [Q9BRY0-2]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		29985

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:29985

UCSC genome browser

More...UCSCi		uc002lwg.4, human [Q9BRY0-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK002044 mRNA Translation: BAG51005.1
BC005869 mRNA Translation: AAH05869.2
BC020571 mRNA Translation: AAH20571.1
CCDSiCCDS12093.1 [Q9BRY0-1]
CCDS45909.1 [Q9BRY0-2]
RefSeqiNP_653165.2, NM_144564.4 [Q9BRY0-1]
NP_998733.1, NM_213568.1 [Q9BRY0-2]

3D structure databases

Database of comparative protein structure models

More...ModBasei		Search...

SWISS-MODEL Interactive Workspace

More...SWISS-MODEL-Workspacei		Submit a new modelling project...

Protein-protein interaction databases

BioGRIDi119011, 42 interactors
IntActiQ9BRY0, 8 interactors
STRINGi9606.ENSP00000269740

Chemistry databases

DrugBankiDB14533, Zinc chloride
DB14548, Zinc sulfate, unspecified form

Protein family/group databases

TCDBi2.A.5.3.3, the zinc (zn(2+))-iron (fe(2+)) permease (zip) family

PTM databases

iPTMnetiQ9BRY0
PhosphoSitePlusiQ9BRY0

Polymorphism and mutation databases

BioMutaiSLC39A3
DMDMi74732942

Proteomic databases

EPDiQ9BRY0
jPOSTiQ9BRY0
MassIVEiQ9BRY0
MaxQBiQ9BRY0
PaxDbiQ9BRY0
PeptideAtlasiQ9BRY0
PRIDEiQ9BRY0
ProteomicsDBi78852 [Q9BRY0-1]
78853 [Q9BRY0-2]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		23039, 112 antibodies

Genome annotation databases

EnsembliENST00000269740; ENSP00000269740; ENSG00000141873 [Q9BRY0-1]
ENST00000455372; ENSP00000393715; ENSG00000141873 [Q9BRY0-2]
GeneIDi29985
KEGGihsa:29985
UCSCiuc002lwg.4, human [Q9BRY0-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		29985
DisGeNETi29985
EuPathDBiHostDB:ENSG00000141873.10

GeneCards: human genes, protein and diseases

More...GeneCardsi		SLC39A3
HGNCiHGNC:17128, SLC39A3
HPAiENSG00000141873, Low tissue specificity
MIMi612168, gene
neXtProtiNX_Q9BRY0
OpenTargetsiENSG00000141873
PharmGKBiPA38203

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG1558, Eukaryota
GeneTreeiENSGT00940000160231
HOGENOMiCLU_040462_4_1_1
InParanoidiQ9BRY0
OrthoDBi981397at2759
PhylomeDBiQ9BRY0
TreeFamiTF317098

Enzyme and pathway databases

PathwayCommonsiQ9BRY0
ReactomeiR-HSA-442380, Zinc influx into cells by the SLC39 gene family

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		29985, 5 hits in 842 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		SLC39A3, human

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		SLC39A3

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		29985
PharosiQ9BRY0, Tbio

Protein Ontology

More...PROi		PR:Q9BRY0
RNActiQ9BRY0, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000141873, Expressed in muscle tissue and 188 other tissues
ExpressionAtlasiQ9BRY0, baseline and differential
GenevisibleiQ9BRY0, HS

Family and domain databases

InterProiView protein in InterPro
IPR003689, ZIP
PfamiView protein in Pfam
PF02535, Zip, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiS39A3_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9BRY0
Secondary accession number(s): B3KMJ3, Q8WUG1
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: December 4, 2007
Last sequence update: March 1, 2004
Last modified: December 2, 2020
This is version 145 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families
  4. Human chromosome 19
    Human chromosome 19: entries, gene names and cross-references to MIM
  5. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again