Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

DNA replication complex GINS protein PSF3

Gene

GINS3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

The GINS complex plays an essential role in the initiation of DNA replication, and progression of DNA replication forks. GINS complex seems to bind preferentially to single-stranded DNA.1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processDNA replication

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-176974 Unwinding of DNA

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
DNA replication complex GINS protein PSF3
Alternative name(s):
GINS complex subunit 3
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:GINS3
Synonyms:PSF3
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 16

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000181938.13

Human Gene Nomenclature Database

More...
HGNCi
HGNC:25851 GINS3

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
610610 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q9BRX5

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
64785

Open Targets

More...
OpenTargetsi
ENSG00000181938

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA145008327

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
GINS3

Domain mapping of disease mutations (DMDM)

More...
DMDMi
74732939

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003276151 – 216DNA replication complex GINS protein PSF3Add BLAST216

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q9BRX5

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q9BRX5

PeptideAtlas

More...
PeptideAtlasi
Q9BRX5

PRoteomics IDEntifications database

More...
PRIDEi
Q9BRX5

ProteomicsDB human proteome resource

More...
ProteomicsDBi
78847
78848 [Q9BRX5-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9BRX5

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9BRX5

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000181938 Expressed in 189 organ(s), highest expression level in vagina

CleanEx database of gene expression profiles

More...
CleanExi
HS_GINS3

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q9BRX5 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9BRX5 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA041216
HPA048209

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Component of the GINS complex which is a heterotetramer of GINS1, GINS2, GINS3 and GINS4. Forms a stable subcomplex with GINS2. GINS complex interacts with DNA primase in vitro.6 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
122295, 40 interactors

CORUM comprehensive resource of mammalian protein complexes

More...
CORUMi
Q9BRX5

Database of interacting proteins

More...
DIPi
DIP-29333N

Protein interaction database and analysis system

More...
IntActi
Q9BRX5, 13 interactors

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1216
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
Q9BRX5

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q9BRX5

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
Q9BRX5

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni1 – 16Not essential for folding and stability of GINS complex, but may regulate accessibility to the central complex poreAdd BLAST16

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the GINS3/PSF3 family.Curated

Phylogenomic databases

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000001622

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000007879

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG057574

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9BRX5

KEGG Orthology (KO)

More...
KOi
K10734

Identification of Orthologs from Complete Genome Data

More...
OMAi
GTKMELP

Database of Orthologous Groups

More...
OrthoDBi
EOG091G0QNW

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9BRX5

TreeFam database of animal gene trees

More...
TreeFami
TF314626

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.20.58.2050, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR021151 GINS_A
IPR036224 GINS_bundle-like_dom_sf
IPR010492 GINS_Psf3
IPR038437 GINS_Psf3_sf

The PANTHER Classification System

More...
PANTHERi
PTHR22768 PTHR22768, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF05916 Sld5, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF158573 SSF158573, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: Q9BRX5-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSEAYFRVES GALGPEENFL SLDDILMSHE KLPVRTETAM PRLGAFFLER
60 70 80 90 100
SAGAETDNAV PQGSKLELPL WLAKGLFDNK RRILSVELPK IYQEGWRTVF
110 120 130 140 150
SADPNVVDLH KMGPHFYGFG SQLLHFDSPE NADISQSLLQ TFIGRFRRIM
160 170 180 190 200
DSSQNAYNED TSALVARLDE MERGLFQTGQ KGLNDFQCWE KGQASQITAS
210
NLVQNYKKRK FTDMED
Length:216
Mass (Da):24,535
Last modified:June 1, 2001 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iA1B264A72371C551
GO
Isoform 2 (identifier: Q9BRX5-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     62-139: Missing.

Show »
Length:138
Mass (Da):15,655
Checksum:i50D249B01A5F66EE
GO
Isoform 3 (identifier: Q9BRX5-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     63-63: G → GFALLPRLECSGVIWLTAALTSQAPEILPPQPPMWLVLQG

Note: Gene prediction based on EST data.
Show »
Length:255
Mass (Da):28,775
Checksum:i99614F114B6B6CF1
GO

<p>This subsection of the ‘Sequence’ section reports information derived from mass spectrometry experiments done on the entire protein or on biologically active derived peptide(s).<p><a href='/help/mass_spectrometry' target='_top'>More...</a></p>Mass spectrometryi

Molecular mass is 98373±13 Da from positions 1 - 216. Determined by ESI. This is the measured mass for the GINS complex.1 Publication

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_03273762 – 139Missing in isoform 2. 2 PublicationsAdd BLAST78
Alternative sequenceiVSP_04669463G → GFALLPRLECSGVIWLTAAL TSQAPEILPPQPPMWLVLQG in isoform 3. Curated1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AK023974 mRNA Translation: BAB14747.1
AK315622 mRNA Translation: BAG37990.1
CR457283 mRNA Translation: CAG33564.1
AC009107 Genomic DNA No translation available.
AC009118 Genomic DNA No translation available.
AC084063 Genomic DNA No translation available.
CH471092 Genomic DNA Translation: EAW82973.1
CH471092 Genomic DNA Translation: EAW82976.1
BC005879 mRNA Translation: AAH05879.1
BC014437 mRNA Translation: AAH14437.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS10796.1 [Q9BRX5-1]
CCDS45498.1 [Q9BRX5-3]
CCDS45499.1 [Q9BRX5-2]

NCBI Reference Sequences

More...
RefSeqi
NP_001119601.1, NM_001126129.1 [Q9BRX5-3]
NP_001119602.1, NM_001126130.1 [Q9BRX5-2]
NP_073607.2, NM_022770.3 [Q9BRX5-1]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.47125
Hs.605546

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000318129; ENSP00000318196; ENSG00000181938 [Q9BRX5-1]
ENST00000328514; ENSP00000327449; ENSG00000181938 [Q9BRX5-2]
ENST00000426538; ENSP00000401018; ENSG00000181938 [Q9BRX5-3]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
64785

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:64785

UCSC genome browser

More...
UCSCi
uc002enh.4 human [Q9BRX5-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK023974 mRNA Translation: BAB14747.1
AK315622 mRNA Translation: BAG37990.1
CR457283 mRNA Translation: CAG33564.1
AC009107 Genomic DNA No translation available.
AC009118 Genomic DNA No translation available.
AC084063 Genomic DNA No translation available.
CH471092 Genomic DNA Translation: EAW82973.1
CH471092 Genomic DNA Translation: EAW82976.1
BC005879 mRNA Translation: AAH05879.1
BC014437 mRNA Translation: AAH14437.1
CCDSiCCDS10796.1 [Q9BRX5-1]
CCDS45498.1 [Q9BRX5-3]
CCDS45499.1 [Q9BRX5-2]
RefSeqiNP_001119601.1, NM_001126129.1 [Q9BRX5-3]
NP_001119602.1, NM_001126130.1 [Q9BRX5-2]
NP_073607.2, NM_022770.3 [Q9BRX5-1]
UniGeneiHs.47125
Hs.605546

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2E9XX-ray2.30C/G1-216[»]
2EHOX-ray3.00D/H/L1-216[»]
2Q9QX-ray2.36D/H2-216[»]
ProteinModelPortaliQ9BRX5
SMRiQ9BRX5
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi122295, 40 interactors
CORUMiQ9BRX5
DIPiDIP-29333N
IntActiQ9BRX5, 13 interactors

PTM databases

iPTMnetiQ9BRX5
PhosphoSitePlusiQ9BRX5

Polymorphism and mutation databases

BioMutaiGINS3
DMDMi74732939

Proteomic databases

EPDiQ9BRX5
MaxQBiQ9BRX5
PeptideAtlasiQ9BRX5
PRIDEiQ9BRX5
ProteomicsDBi78847
78848 [Q9BRX5-2]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
64785
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000318129; ENSP00000318196; ENSG00000181938 [Q9BRX5-1]
ENST00000328514; ENSP00000327449; ENSG00000181938 [Q9BRX5-2]
ENST00000426538; ENSP00000401018; ENSG00000181938 [Q9BRX5-3]
GeneIDi64785
KEGGihsa:64785
UCSCiuc002enh.4 human [Q9BRX5-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
64785
DisGeNETi64785
EuPathDBiHostDB:ENSG00000181938.13

GeneCards: human genes, protein and diseases

More...
GeneCardsi
GINS3
HGNCiHGNC:25851 GINS3
HPAiHPA041216
HPA048209
MIMi610610 gene
neXtProtiNX_Q9BRX5
OpenTargetsiENSG00000181938
PharmGKBiPA145008327

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

GeneTreeiENSGT00390000001622
HOGENOMiHOG000007879
HOVERGENiHBG057574
InParanoidiQ9BRX5
KOiK10734
OMAiGTKMELP
OrthoDBiEOG091G0QNW
PhylomeDBiQ9BRX5
TreeFamiTF314626

Enzyme and pathway databases

ReactomeiR-HSA-176974 Unwinding of DNA

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
GINS3 human
EvolutionaryTraceiQ9BRX5

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
64785

Protein Ontology

More...
PROi
PR:Q9BRX5

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000181938 Expressed in 189 organ(s), highest expression level in vagina
CleanExiHS_GINS3
ExpressionAtlasiQ9BRX5 baseline and differential
GenevisibleiQ9BRX5 HS

Family and domain databases

Gene3Di1.20.58.2050, 1 hit
InterProiView protein in InterPro
IPR021151 GINS_A
IPR036224 GINS_bundle-like_dom_sf
IPR010492 GINS_Psf3
IPR038437 GINS_Psf3_sf
PANTHERiPTHR22768 PTHR22768, 1 hit
PfamiView protein in Pfam
PF05916 Sld5, 1 hit
SUPFAMiSSF158573 SSF158573, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiPSF3_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9BRX5
Secondary accession number(s): B2RDP3, E9PB21, Q9H870
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 8, 2008
Last sequence update: June 1, 2001
Last modified: September 12, 2018
This is version 134 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. SIMILARITY comments
    Index of protein domains and families
  3. Human chromosome 16
    Human chromosome 16: entries, gene names and cross-references to MIM
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again