Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 151 (13 Feb 2019)
Sequence version 2 (16 May 2006)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Proteasomal ATPase-associated factor 1

Gene

PAAF1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:4 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Inhibits proteasome 26S assembly and proteolytic activity by impairing the association of the 19S regulatory complex with the 20S core. In case of HIV-1 infection, recruited by viral Tat to the HIV-1 promoter, where it promotes the recruitment of 19S regulatory complex through dissociation of the proteasome 26S. This presumably promotes provirus transcription efficiency. Protects SUPT6H from proteasomal degradation.3 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processHost-virus interaction

Enzyme and pathway databases

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...
SignaLinki
Q9BRP4

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Proteasomal ATPase-associated factor 1
Alternative name(s):
Protein G-16
WD repeat-containing protein 71
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:PAAF1
Synonyms:WDR71
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 11

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000175575.12

Human Gene Nomenclature Database

More...
HGNCi
HGNC:25687 PAAF1

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q9BRP4

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Keywords - Cellular componenti

Proteasome

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

Open Targets

More...
OpenTargetsi
ENSG00000175575

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA162398551

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
PAAF1

Domain mapping of disease mutations (DMDM)

More...
DMDMi
97217547

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section indicates that the initiator methionine is cleaved from the mature protein.<p><a href='/help/init_met' target='_top'>More...</a></p>Initiator methionineiRemovedCombined sources
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002356852 – 392Proteasomal ATPase-associated factor 1Add BLAST391

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei2N-acetylalanineCombined sources1

Keywords - PTMi

Acetylation

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q9BRP4

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q9BRP4

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q9BRP4

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9BRP4

PeptideAtlas

More...
PeptideAtlasi
Q9BRP4

PRoteomics IDEntifications database

More...
PRIDEi
Q9BRP4

ProteomicsDB human proteome resource

More...
ProteomicsDBi
78795
78796 [Q9BRP4-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9BRP4

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9BRP4

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Ubiquitously expressed, with highest levels in kidney, brain and testis.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000175575 Expressed in 212 organ(s), highest expression level in substantia nigra

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q9BRP4 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9BRP4 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA039952
HPA040020

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with PSMC1, PSMC2, PSMC3, PSMC4, PSMC5 and PSMC6. Interacts with SUPT6H.2 Publications
(Microbial infection) Interacts with HIV-1 Tat.1 Publication

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

WithEntry#Exp.IntActNotes
PSMC5P621952EBI-1056358,EBI-357745

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
123191, 42 interactors

Protein interaction database and analysis system

More...
IntActi
Q9BRP4, 9 interactors

Molecular INTeraction database

More...
MINTi
Q9BRP4

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000311665

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
Q9BRP4

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q9BRP4

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section indicates the positions and types of repeated sequence motifs or repeated domains within the protein.<p><a href='/help/repeat' target='_top'>More...</a></p>Repeati82 – 121WD 1Add BLAST40
Repeati125 – 163WD 2Add BLAST39
Repeati167 – 205WD 3Add BLAST39
Repeati209 – 259WD 4Add BLAST51
Repeati270 – 308WD 5Add BLAST39
Repeati313 – 349WD 6Add BLAST37
Repeati353 – 389WD 7Add BLAST37

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the WD repeat PAAF1/RPN14 family.Curated

Keywords - Domaini

Repeat, WD repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IQ12 Eukaryota
ENOG410XWCN LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000005948

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000006858

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG056033

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9BRP4

KEGG Orthology (KO)

More...
KOi
K11887

Identification of Orthologs from Complete Genome Data

More...
OMAi
VYDVNCC

Database of Orthologous Groups

More...
OrthoDBi
736374at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9BRP4

TreeFam database of animal gene trees

More...
TreeFami
TF313690

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
2.130.10.10, 2 hits

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR020472 G-protein_beta_WD-40_rep
IPR015943 WD40/YVTN_repeat-like_dom_sf
IPR001680 WD40_repeat
IPR019775 WD40_repeat_CS
IPR017986 WD40_repeat_dom
IPR036322 WD40_repeat_dom_sf

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00400 WD40, 3 hits

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR00320 GPROTEINBRPT

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00320 WD40, 6 hits

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF50978 SSF50978, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00678 WD_REPEATS_1, 1 hit
PS50082 WD_REPEATS_2, 3 hits
PS50294 WD_REPEATS_REGION, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 7 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9BRP4-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAAPLRIQSD WAQALRKDEG EAWLSCHPPG KPSLYGSLTC QGIGLDGIPE
60 70 80 90 100
VTASEGFTVN EINKKSIHIS CPKENASSKF LAPYTTFSRI HTKSITCLDI
110 120 130 140 150
SSRGGLGVSS STDGTMKIWQ ASNGELRRVL EGHVFDVNCC RFFPSGLVVL
160 170 180 190 200
SGGMDAQLKI WSAEDASCVV TFKGHKGGIL DTAIVDRGRN VVSASRDGTA
210 220 230 240 250
RLWDCGRSAC LGVLADCGSS INGVAVGAAD NSINLGSPEQ MPSEREVGTE
260 270 280 290 300
AKMLLLARED KKLQCLGLQS RQLVFLFIGS DAFNCCTFLS GFLLLAGTQD
310 320 330 340 350
GNIYQLDVRS PRAPVQVIHR SGAPVLSLLS VRDGFIASQG DGSCFIVQQD
360 370 380 390
LDYVTELTGA DCDPVYKVAT WEKQIYTCCR DGLVRRYQLS DL
Length:392
Mass (Da):42,190
Last modified:May 16, 2006 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i54ECB1DEC1841B49
GO
Isoform 2 (identifier: Q9BRP4-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-30: MAAPLRIQSDWAQALRKDEGEAWLSCHPPG → MLVPCFLYSLQNR

Show »
Length:375
Mass (Da):40,439
Checksum:iC9AAF37840B5F43A
GO
Isoform 3 (identifier: Q9BRP4-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-115: Missing.

Note: No experimental confirmation available.
Show »
Length:277
Mass (Da):29,982
Checksum:i00F78074BBD2F913
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 7 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
F5H0F7F5H0F7_HUMAN
Proteasomal ATPase-associated facto...
PAAF1
161Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F5H0C4F5H0C4_HUMAN
Proteasomal ATPase-associated facto...
PAAF1
393Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F5H3I1F5H3I1_HUMAN
Proteasomal ATPase-associated facto...
PAAF1
247Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F5H103F5H103_HUMAN
Proteasomal ATPase-associated facto...
PAAF1
237Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F5H5D4F5H5D4_HUMAN
Proteasomal ATPase-associated facto...
PAAF1
150Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F5H3E9F5H3E9_HUMAN
Proteasomal ATPase-associated facto...
PAAF1
100Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YGB1H0YGB1_HUMAN
Proteasomal ATPase-associated facto...
PAAF1
117Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_02641553A → V1 PublicationCorresponds to variant dbSNP:rs17850051Ensembl.1
Natural variantiVAR_032082139C → S1 PublicationCorresponds to variant dbSNP:rs2067912Ensembl.1
Natural variantiVAR_026416209A → G3 PublicationsCorresponds to variant dbSNP:rs3741138Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0446991 – 115Missing in isoform 3. 1 PublicationAdd BLAST115
Alternative sequenceiVSP_0184771 – 30MAAPL…CHPPG → MLVPCFLYSLQNR in isoform 2. 2 PublicationsAdd BLAST30

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF087895 mRNA Translation: AAP97194.1
AK021910 mRNA Translation: BAB13933.1
AK222501 mRNA Translation: BAD96221.1
AK298258 mRNA Translation: BAG60522.1
AK316394 mRNA Translation: BAH14765.1
AP002770 Genomic DNA No translation available.
CH471076 Genomic DNA Translation: EAW74917.1
BC006142 mRNA Translation: AAH06142.2
BC021541 mRNA Translation: AAH21541.1
BC028628 mRNA Translation: AAH28628.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS58157.1 [Q9BRP4-2]
CCDS58158.1 [Q9BRP4-3]
CCDS8226.1 [Q9BRP4-1]

NCBI Reference Sequences

More...
RefSeqi
NP_001254732.1, NM_001267803.1 [Q9BRP4-2]
NP_001254733.1, NM_001267804.1 [Q9BRP4-2]
NP_001254734.1, NM_001267805.1 [Q9BRP4-2]
NP_001254735.1, NM_001267806.1 [Q9BRP4-3]
NP_079431.1, NM_025155.2 [Q9BRP4-1]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.525017

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000310571; ENSP00000311665; ENSG00000175575 [Q9BRP4-1]
ENST00000376384; ENSP00000365564; ENSG00000175575 [Q9BRP4-2]
ENST00000535604; ENSP00000438789; ENSG00000175575 [Q9BRP4-3]
ENST00000536003; ENSP00000438124; ENSG00000175575 [Q9BRP4-2]
ENST00000541951; ENSP00000441333; ENSG00000175575 [Q9BRP4-3]
ENST00000544552; ENSP00000441494; ENSG00000175575 [Q9BRP4-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
80227

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:80227

UCSC genome browser

More...
UCSCi
uc001ouk.3 human [Q9BRP4-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF087895 mRNA Translation: AAP97194.1
AK021910 mRNA Translation: BAB13933.1
AK222501 mRNA Translation: BAD96221.1
AK298258 mRNA Translation: BAG60522.1
AK316394 mRNA Translation: BAH14765.1
AP002770 Genomic DNA No translation available.
CH471076 Genomic DNA Translation: EAW74917.1
BC006142 mRNA Translation: AAH06142.2
BC021541 mRNA Translation: AAH21541.1
BC028628 mRNA Translation: AAH28628.1
CCDSiCCDS58157.1 [Q9BRP4-2]
CCDS58158.1 [Q9BRP4-3]
CCDS8226.1 [Q9BRP4-1]
RefSeqiNP_001254732.1, NM_001267803.1 [Q9BRP4-2]
NP_001254733.1, NM_001267804.1 [Q9BRP4-2]
NP_001254734.1, NM_001267805.1 [Q9BRP4-2]
NP_001254735.1, NM_001267806.1 [Q9BRP4-3]
NP_079431.1, NM_025155.2 [Q9BRP4-1]
UniGeneiHs.525017

3D structure databases

ProteinModelPortaliQ9BRP4
SMRiQ9BRP4
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi123191, 42 interactors
IntActiQ9BRP4, 9 interactors
MINTiQ9BRP4
STRINGi9606.ENSP00000311665

PTM databases

iPTMnetiQ9BRP4
PhosphoSitePlusiQ9BRP4

Polymorphism and mutation databases

BioMutaiPAAF1
DMDMi97217547

Proteomic databases

EPDiQ9BRP4
jPOSTiQ9BRP4
MaxQBiQ9BRP4
PaxDbiQ9BRP4
PeptideAtlasiQ9BRP4
PRIDEiQ9BRP4
ProteomicsDBi78795
78796 [Q9BRP4-2]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
80227
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000310571; ENSP00000311665; ENSG00000175575 [Q9BRP4-1]
ENST00000376384; ENSP00000365564; ENSG00000175575 [Q9BRP4-2]
ENST00000535604; ENSP00000438789; ENSG00000175575 [Q9BRP4-3]
ENST00000536003; ENSP00000438124; ENSG00000175575 [Q9BRP4-2]
ENST00000541951; ENSP00000441333; ENSG00000175575 [Q9BRP4-3]
ENST00000544552; ENSP00000441494; ENSG00000175575 [Q9BRP4-2]
GeneIDi80227
KEGGihsa:80227
UCSCiuc001ouk.3 human [Q9BRP4-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
80227
EuPathDBiHostDB:ENSG00000175575.12

GeneCards: human genes, protein and diseases

More...
GeneCardsi
PAAF1

H-Invitational Database, human transcriptome db

More...
H-InvDBi
HIX0009924
HGNCiHGNC:25687 PAAF1
HPAiHPA039952
HPA040020
neXtProtiNX_Q9BRP4
OpenTargetsiENSG00000175575
PharmGKBiPA162398551

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG410IQ12 Eukaryota
ENOG410XWCN LUCA
GeneTreeiENSGT00390000005948
HOGENOMiHOG000006858
HOVERGENiHBG056033
InParanoidiQ9BRP4
KOiK11887
OMAiVYDVNCC
OrthoDBi736374at2759
PhylomeDBiQ9BRP4
TreeFamiTF313690

Enzyme and pathway databases

SignaLinkiQ9BRP4

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
PAAF1 human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
PAAF1

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
80227

Protein Ontology

More...
PROi
PR:Q9BRP4

Gene expression databases

BgeeiENSG00000175575 Expressed in 212 organ(s), highest expression level in substantia nigra
ExpressionAtlasiQ9BRP4 baseline and differential
GenevisibleiQ9BRP4 HS

Family and domain databases

Gene3Di2.130.10.10, 2 hits
InterProiView protein in InterPro
IPR020472 G-protein_beta_WD-40_rep
IPR015943 WD40/YVTN_repeat-like_dom_sf
IPR001680 WD40_repeat
IPR019775 WD40_repeat_CS
IPR017986 WD40_repeat_dom
IPR036322 WD40_repeat_dom_sf
PfamiView protein in Pfam
PF00400 WD40, 3 hits
PRINTSiPR00320 GPROTEINBRPT
SMARTiView protein in SMART
SM00320 WD40, 6 hits
SUPFAMiSSF50978 SSF50978, 1 hit
PROSITEiView protein in PROSITE
PS00678 WD_REPEATS_1, 1 hit
PS50082 WD_REPEATS_2, 3 hits
PS50294 WD_REPEATS_REGION, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiPAAF1_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9BRP4
Secondary accession number(s): A6NDR5
, B4DPB0, B7ZAS9, Q4G165, Q53HS9, Q7Z500, Q8TBU6, Q9HAB6
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 16, 2006
Last sequence update: May 16, 2006
Last modified: February 13, 2019
This is version 151 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 11
    Human chromosome 11: entries, gene names and cross-references to MIM
  2. SIMILARITY comments
    Index of protein domains and families
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again