Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - Q9BRI3 (ZNT2_HUMAN)

Entry version 160 (10 Feb 2021)
Sequence version 1 (01 Jun 2001)
Previous versions | rss
Add a publicationFeedback
Protein

Zinc transporter 2

Gene

SLC30A2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • identical protein binding Source: IntAct
  • zinc ion transmembrane transporter activity Source: GO_Central
Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processIon transport, Transport, Zinc transport
LigandZinc

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		Q9BRI3

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-435368, Zinc efflux and compartmentalization by the SLC30 family

Protein family/group databases

Transport Classification Database

More...TCDBi		2.A.4.3.6, the cation diffusion facilitator (cdf) family

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Zinc transporter 2
Short name:
ZnT-2
Alternative name(s):
Solute carrier family 30 member 2
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:SLC30A2
Synonyms:ZNT2
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 1

Organism-specific databases

Human Gene Nomenclature Database

More...HGNCi		HGNC:11013, SLC30A2

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		609617, gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_Q9BRI3

Eukaryotic Pathogen, Vector and Host Database Resources

More...VEuPathDBi		HostDB:ENSG00000158014.14

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini1 – 91CytoplasmicSequence analysisAdd BLAST91
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei92 – 112HelicalSequence analysisAdd BLAST21
Topological domaini113 – 126VacuolarSequence analysisAdd BLAST14
Transmembranei127 – 147HelicalSequence analysisAdd BLAST21
Topological domaini148 – 171CytoplasmicSequence analysisAdd BLAST24
Transmembranei172 – 192HelicalSequence analysisAdd BLAST21
Topological domaini193 – 200VacuolarSequence analysis8
Transmembranei201 – 221HelicalSequence analysisAdd BLAST21
Topological domaini222 – 255CytoplasmicSequence analysisAdd BLAST34
Transmembranei256 – 276HelicalSequence analysisAdd BLAST21
Topological domaini277 – 323VacuolarSequence analysisAdd BLAST47

Keywords - Cellular componenti

Lysosome, Membrane, Vacuole

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the 'Pathology and Biotech' section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

Zinc deficiency, transient neonatal (TNZD)2 Publications
The disease is caused by variants affecting the gene represented in this entry.
Disease descriptionA disorder occurring in breast-fed infants as a consequence of low milk zinc concentration in their nursing mothers, which cannot be corrected by maternal zinc supplementation. A large amount of zinc, an essential trace mineral, is required for normal growth particularly in infants, and breast milk normally contains adequate zinc to meet the requirement for infants up to 4 to 6 months of age. Zinc deficiency can lead to dermatitis, alopecia, decreased growth, and impaired immune function. The disorder shows autosomal dominant inheritance with incomplete penetrance.
Related information in OMIM
Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_06930954H → R in TNZD; there are lower free protein levels compared to wild-type due to abnormal intracellular perinuclear aggregation of the mutant protein which is most likely due to protein misfolding. 1 PublicationCorresponds to variant dbSNP:rs587776926EnsemblClinVar.1
Natural variantiVAR_06931087G → R in TNZD; inactivating mutation inflicting a dominant negative effect; the mutant protein shows mislocalization being largely retained in the Golgi apparatus or endoplasmic reticulum or in the perinuclear region. 1 PublicationCorresponds to variant dbSNP:rs185398527EnsemblClinVar.1

Keywords - Diseasei

Disease variant

Organism-specific databases

DisGeNET

More...DisGeNETi		7780

MalaCards human disease database

More...MalaCardsi		SLC30A2
MIMi608118, phenotype

Open Targets

More...OpenTargetsi		ENSG00000158014

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA35883

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		Q9BRI3, Tbio

Chemistry databases

Drug and drug target database

More...DrugBanki		DB14533, Zinc chloride
DB14548, Zinc sulfate, unspecified form

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		SLC30A2

Domain mapping of disease mutations (DMDM)

More...DMDMi		60390858

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002060941 – 323Zinc transporter 2Add BLAST323

Proteomic databases

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		Q9BRI3

PeptideAtlas

More...PeptideAtlasi		Q9BRI3

PRoteomics IDEntifications database

More...PRIDEi		Q9BRI3

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		78767 [Q9BRI3-1]
78768 [Q9BRI3-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q9BRI3

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q9BRI3

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000158014, Expressed in body of pancreas and 103 other tissues

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q9BRI3, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000158014, Tissue enhanced (pancreas, placenta)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Homodimer.

1 Publication

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Q9BRI3
With#Exp.IntAct
ABHD16A [O95870]3EBI-8644112,EBI-348517
ADAM33 [Q08AM2]8EBI-8644112,EBI-10225815
ADAM33 - isoform 2 [Q9BZ11-2]3EBI-8644112,EBI-10303054
AQP2 [P41181]3EBI-8644112,EBI-12701138
AQP6 [Q13520]3EBI-8644112,EBI-13059134
ATP13A1 - isoform C [Q9HD20-3]3EBI-8644112,EBI-12069500
C5orf46 [Q6UWT4]5EBI-8644112,EBI-11986083
CCL4 [P13236]8EBI-8644112,EBI-2873970
CCL4L2 [Q8NHW4]3EBI-8644112,EBI-10271156
CD40 [P25942]3EBI-8644112,EBI-525714
CD79A [P11912]3EBI-8644112,EBI-7797864
CD99L2 [A0A0S2Z5R8]3EBI-8644112,EBI-16434925
CDW52 [Q6IBD0]3EBI-8644112,EBI-12011352
CPLX4 [Q7Z7G2]3EBI-8644112,EBI-18013275
CREB3 - isoform 1 [O43889-2]3EBI-8644112,EBI-625022
CYB561D2 [O14569]3EBI-8644112,EBI-717654
EBAG9 [O00559]3EBI-8644112,EBI-8787095
EMP3 [P54852]3EBI-8644112,EBI-3907816
EVI2B - isoform 2 [P34910-2]3EBI-8644112,EBI-17640610
F11R [Q9Y624]3EBI-8644112,EBI-742600
FAM174A [Q8TBP5]3EBI-8644112,EBI-18636064
FDPS [P14324]3EBI-8644112,EBI-948245
FFAR2 [O15552]3EBI-8644112,EBI-2833872
FXYD3 - isoform 3 [Q14802-3]3EBI-8644112,EBI-12175685
FXYD6 [Q9H0Q3]3EBI-8644112,EBI-713304
GALNT15 [Q8N3T1]5EBI-8644112,EBI-3925203
GJA5 [P36382]3EBI-8644112,EBI-750433
GJB2 [P29033]3EBI-8644112,EBI-3905204
GJB5 [O95377]3EBI-8644112,EBI-3909454
GLB1 [P16278]3EBI-8644112,EBI-989638
GOLT1A [Q6ZVE7]3EBI-8644112,EBI-17231387
GPR161 [Q8N6U8]3EBI-8644112,EBI-6255622
GPR42 [O15529]3EBI-8644112,EBI-18076404
GPRC5D [Q9NZD1]3EBI-8644112,EBI-13067820
HGFAC [Q04756]3EBI-8644112,EBI-1041722
IL10RA [Q13651]3EBI-8644112,EBI-1031656
KASH5 [Q8N6L0]9EBI-8644112,EBI-749265
KCNN4 [O15554]3EBI-8644112,EBI-2924473
LTA [P01374]5EBI-8644112,EBI-524105
LTA [Q6FG55]3EBI-8644112,EBI-11984863
LYVE1 [Q9Y5Y7]3EBI-8644112,EBI-10329546
MS4A13 [Q5J8X5]6EBI-8644112,EBI-12070086
NDUFAF1 [Q9Y375]3EBI-8644112,EBI-741874
NRM [Q8IXM6]3EBI-8644112,EBI-10262547
OPRM1 - isoform 10 [P35372-10]3EBI-8644112,EBI-12807478
PCNX2 - isoform 5 [A6NKB5-5]3EBI-8644112,EBI-17616589
PLPPR1 [Q8TBJ4]3EBI-8644112,EBI-18063495
PPGB [Q59EV6]3EBI-8644112,EBI-14210385
PVR [P15151]11EBI-8644112,EBI-3919694
SEC22A [Q96IW7]3EBI-8644112,EBI-8652744
SELL - isoform 2 [P14151-2]3EBI-8644112,EBI-17865914
SERPING1 [E9PK97]3EBI-8644112,EBI-16434941
SLC10A6 [Q3KNW5]3EBI-8644112,EBI-18159983
SLC18A1 - isoform 3 [P54219-3]3EBI-8644112,EBI-17595455
SLC30A1 [Q9Y6M5]4EBI-8644112,EBI-10982148
SLC30A10 [Q6XR72]3EBI-8644112,EBI-13917996
itself3EBI-8644112,EBI-8644112
SLC30A3 [Q99726]7EBI-8644112,EBI-10294651
SLC30A4 [O14863]4EBI-8644112,EBI-13918058
SLC38A7 [Q9NVC3]3EBI-8644112,EBI-10314552
SLC39A2 [Q9NP94]3EBI-8644112,EBI-12898013
SLC7A1 [P30825]3EBI-8644112,EBI-4289564
SLC7A8 [Q9UHI5]3EBI-8644112,EBI-13292283
SSMEM1 [Q8WWF3]3EBI-8644112,EBI-17280858
TAS2R5 [Q9NYW4]3EBI-8644112,EBI-17933167
TM4SF18 [Q96CE8]3EBI-8644112,EBI-13351685
TMEM107 [Q6UX40]3EBI-8644112,EBI-12845616
TMEM52B [Q4KMG9]3EBI-8644112,EBI-18178701
TMEM60 [Q9H2L4]5EBI-8644112,EBI-2852148
TMEM86A [Q8N2M4]3EBI-8644112,EBI-12015604
TNFRSF12A [Q9NP84]9EBI-8644112,EBI-2851995
TSPAN31 [Q12999]3EBI-8644112,EBI-17678331
TUSC5 [A5PKU2]3EBI-8644112,EBI-11988865
YIPF2 [Q9BWQ6]3EBI-8644112,EBI-751204
Tfrc [Q99376] from Rattus norvegicus.3EBI-8644112,EBI-2112551

GO - Molecular functioni

Complete GO annotation on QuickGO ...

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		113561, 69 interactors

Protein interaction database and analysis system

More...IntActi		Q9BRI3, 74 interactors

Molecular INTeraction database

More...MINTi		Q9BRI3

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		Q9BRI3, protein

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the cation diffusion facilitator (CDF) transporter (TC 2.A.4) family. SLC30A subfamily. [View classification]Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

Ensembl GeneTree

More...GeneTreei		ENSGT00940000156072

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_013430_0_1_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q9BRI3

Identification of Orthologs from Complete Genome Data

More...OMAi		TIQMERQ

Database of Orthologous Groups

More...OrthoDBi		973492at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q9BRI3

TreeFam database of animal gene trees

More...TreeFami		TF313382

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...Gene3Di		1.20.1510.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR002524, Cation_efflux
IPR036837, Cation_efflux_CTD_sf
IPR027469, Cation_efflux_TMD_sf

Pfam protein domain database

More...Pfami		View protein in Pfam
PF01545, Cation_efflux, 1 hit

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF160240, SSF160240, 1 hit
SSF161111, SSF161111, 1 hit

TIGRFAMs; a protein family database

More...TIGRFAMsi		TIGR01297, CDF, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: Q9BRI3-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MEAKEKQHLL DARPAIRSYT GSLWQEGAGW IPLPRPGLDL QAIELAAQSN 
        60         70         80         90        100
HHCHAQKGPD SHCDPKKGKA QRQLYVASAI CLLFMIGEVV EILGALVSVL 
       110        120        130        140        150
SIWVVTGVLV YLAVERLISG DYEIDGGTML ITSGCAVAVN IIMGLTLHQS 
       160        170        180        190        200
GHGHSHGTTN QQEENPSVRA AFIHVIGDFM QSMGVLVAAY ILYFKPEYKY 
       210        220        230        240        250
VDPICTFVFS ILVLGTTLTI LRDVILVLME GTPKGVDFTA VRDLLLSVEG 
       260        270        280        290        300
VEALHSLHIW ALTVAQPVLS VHIAIAQNTD AQAVLKTASS RLQGKFHFHT 
       310        320 
VTIQIEDYSE DMKDCQACQG PSD
Length:323
Mass (Da):35,178
Last modified:June 1, 2001 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iF487412DEC7B38CB
GO
Isoform 2 (identifier: Q9BRI3-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     90-90: V → VGGYLAHSLAVMTDAAHLLTDFASMLISLFSLWMSSRPATKTMNFGWQRA

Show »
Length:372
Mass (Da):40,564
Checksum:i0B004533D3B6D29C
GO

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_06930954H → R in TNZD; there are lower free protein levels compared to wild-type due to abnormal intracellular perinuclear aggregation of the mutant protein which is most likely due to protein misfolding. 1 PublicationCorresponds to variant dbSNP:rs587776926EnsemblClinVar.1
Natural variantiVAR_06931087G → R in TNZD; inactivating mutation inflicting a dominant negative effect; the mutant protein shows mislocalization being largely retained in the Golgi apparatus or endoplasmic reticulum or in the perinuclear region. 1 PublicationCorresponds to variant dbSNP:rs185398527EnsemblClinVar.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_03975490V → VGGYLAHSLAVMTDAAHLLT DFASMLISLFSLWMSSRPAT KTMNFGWQRA in isoform 2. 1 Publication1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AF370409 mRNA Translation: AAQ15245.1
AL391650 Genomic DNA No translation available.
BC006251 mRNA Translation: AAH06251.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS272.1 [Q9BRI3-1]
CCDS30644.1 [Q9BRI3-2]

NCBI Reference Sequences

More...RefSeqi		NP_001004434.1, NM_001004434.2 [Q9BRI3-2]
NP_115902.1, NM_032513.4 [Q9BRI3-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000374276; ENSP00000363394; ENSG00000158014 [Q9BRI3-2]
ENST00000374278; ENSP00000363396; ENSG00000158014 [Q9BRI3-1]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		7780

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:7780

UCSC genome browser

More...UCSCi		uc001blg.2, human [Q9BRI3-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF370409 mRNA Translation: AAQ15245.1
AL391650 Genomic DNA No translation available.
BC006251 mRNA Translation: AAH06251.1
CCDSiCCDS272.1 [Q9BRI3-1]
CCDS30644.1 [Q9BRI3-2]
RefSeqiNP_001004434.1, NM_001004434.2 [Q9BRI3-2]
NP_115902.1, NM_032513.4 [Q9BRI3-1]

3D structure databases

Database of comparative protein structure models

More...ModBasei		Search...

SWISS-MODEL Interactive Workspace

More...SWISS-MODEL-Workspacei		Submit a new modelling project...

Protein-protein interaction databases

BioGRIDi113561, 69 interactors
IntActiQ9BRI3, 74 interactors
MINTiQ9BRI3

Chemistry databases

DrugBankiDB14533, Zinc chloride
DB14548, Zinc sulfate, unspecified form

Protein family/group databases

TCDBi2.A.4.3.6, the cation diffusion facilitator (cdf) family

PTM databases

iPTMnetiQ9BRI3
PhosphoSitePlusiQ9BRI3

Genetic variation databases

BioMutaiSLC30A2
DMDMi60390858

Proteomic databases

MassIVEiQ9BRI3
PeptideAtlasiQ9BRI3
PRIDEiQ9BRI3
ProteomicsDBi78767 [Q9BRI3-1]
78768 [Q9BRI3-2]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		15992, 44 antibodies

The DNASU plasmid repository

More...DNASUi		7780

Genome annotation databases

EnsembliENST00000374276; ENSP00000363394; ENSG00000158014 [Q9BRI3-2]
ENST00000374278; ENSP00000363396; ENSG00000158014 [Q9BRI3-1]
GeneIDi7780
KEGGihsa:7780
UCSCiuc001blg.2, human [Q9BRI3-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		7780
DisGeNETi7780

GeneCards: human genes, protein and diseases

More...GeneCardsi		SLC30A2
HGNCiHGNC:11013, SLC30A2
HPAiENSG00000158014, Tissue enhanced (pancreas, placenta)
MalaCardsiSLC30A2
MIMi608118, phenotype
609617, gene
neXtProtiNX_Q9BRI3
OpenTargetsiENSG00000158014
PharmGKBiPA35883
VEuPathDBiHostDB:ENSG00000158014.14

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

GeneTreeiENSGT00940000156072
HOGENOMiCLU_013430_0_1_1
InParanoidiQ9BRI3
OMAiTIQMERQ
OrthoDBi973492at2759
PhylomeDBiQ9BRI3
TreeFamiTF313382

Enzyme and pathway databases

PathwayCommonsiQ9BRI3
ReactomeiR-HSA-435368, Zinc efflux and compartmentalization by the SLC30 family

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		7780, 2 hits in 871 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		SLC30A2, human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		7780
PharosiQ9BRI3, Tbio

Protein Ontology

More...PROi		PR:Q9BRI3
RNActiQ9BRI3, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000158014, Expressed in body of pancreas and 103 other tissues
GenevisibleiQ9BRI3, HS

Family and domain databases

Gene3Di1.20.1510.10, 1 hit
InterProiView protein in InterPro
IPR002524, Cation_efflux
IPR036837, Cation_efflux_CTD_sf
IPR027469, Cation_efflux_TMD_sf
PfamiView protein in Pfam
PF01545, Cation_efflux, 1 hit
SUPFAMiSSF160240, SSF160240, 1 hit
SSF161111, SSF161111, 1 hit
TIGRFAMsiTIGR01297, CDF, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiZNT2_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9BRI3
Secondary accession number(s): Q71RC8
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: March 1, 2005
Last sequence update: June 1, 2001
Last modified: February 10, 2021
This is version 160 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Human variants curated from literature reports
    Index of human variants curated from literature reports
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families
  4. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  5. Human entries with genetic variants
    List of human entries with genetic variants
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again