Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Sulfotransferase 4A1

Gene

SULT4A1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:4 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Atypical sulfotransferase family member with very low affinity for 3'-phospho-5'-adenylyl sulfate (PAPS) and very low catalytic activity towards L-triiodothyronine, thyroxine, estrone, p-nitrophenol, 2-naphthylamine, and 2-beta-naphthol. May have a role in the metabolism of drugs and neurotransmitters in the CNS.1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • aryl sulfotransferase activity Source: Reactome
  • identical protein binding Source: IntAct
  • sulfotransferase activity Source: UniProtKB

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionTransferase
Biological processLipid metabolism, Steroid metabolism

Enzyme and pathway databases

BRENDA Comprehensive Enzyme Information System

More...
BRENDAi
2.8.2.1 2681

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-156584 Cytosolic sulfonation of small molecules

SIGNOR Signaling Network Open Resource

More...
SIGNORi
Q9BR01

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Sulfotransferase 4A1 (EC:2.8.2.-)
Short name:
ST4A1
Alternative name(s):
Brain sulfotransferase-like protein
Short name:
hBR-STL
Short name:
hBR-STL-1
Nervous system sulfotransferase
Short name:
NST
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:SULT4A1
Synonyms:SULTX3
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 22

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000130540.13

Human Gene Nomenclature Database

More...
HGNCi
HGNC:14903 SULT4A1

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
608359 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q9BR01

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
25830

Open Targets

More...
OpenTargetsi
ENSG00000130540

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA412

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...
ChEMBLi
CHEMBL1743298

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
SULT4A1

Domain mapping of disease mutations (DMDM)

More...
DMDMi
22096149

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000851671 – 284Sulfotransferase 4A1Add BLAST284

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei8PhosphothreonineBy similarity1
Modified residuei11PhosphothreonineBy similarity1
Modified residuei205PhosphothreonineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9BR01

PeptideAtlas

More...
PeptideAtlasi
Q9BR01

PRoteomics IDEntifications database

More...
PRIDEi
Q9BR01

ProteomicsDB human proteome resource

More...
ProteomicsDBi
78733
78734 [Q9BR01-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9BR01

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9BR01

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Highly expressed in the cerebral cortex and frontal lobe, slightly less in the cerebellum, occipital and temporal lobes, relatively low in the medulla and putamen, and lowest in the spinal cord. No expression detected in the pancreas (PubMed:10698717). Highly expressed in fetal brain and occipital lobe, slightly less in the whole brain, frontal lobe, hippocampus, and lung, very low expression in cerebellum, medulla oblongata, temporal lobe, testis, kidney and appendix (PubMed:12039030).2 Publications

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000130540 Expressed in 130 organ(s), highest expression level in anterior cingulate cortex

CleanEx database of gene expression profiles

More...
CleanExi
HS_SULT4A1

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q9BR01 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9BR01 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA003129

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
117358, 10 interactors

Protein interaction database and analysis system

More...
IntActi
Q9BR01, 5 interactors

Molecular INTeraction database

More...
MINTi
Q9BR01

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000332565

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1284
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
Q9BR01

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q9BR01

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
Q9BR01

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the sulfotransferase 1 family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG1584 Eukaryota
ENOG4111H56 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000158662

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000037209

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG105932

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9BR01

KEGG Orthology (KO)

More...
KOi
K11823

Identification of Orthologs from Complete Genome Data

More...
OMAi
MVEHCHQ

Database of Orthologous Groups

More...
OrthoDBi
EOG091G0D5F

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9BR01

TreeFam database of animal gene trees

More...
TreeFami
TF321745

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR027417 P-loop_NTPase
IPR000863 Sulfotransferase_dom

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00685 Sulfotransfer_1, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF52540 SSF52540, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9BR01-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAESEAETPS TPGEFESKYF EFHGVRLPPF CRGKMEEIAN FPVRPSDVWI
60 70 80 90 100
VTYPKSGTSL LQEVVYLVSQ GADPDEIGLM NIDEQLPVLE YPQPGLDIIK
110 120 130 140 150
ELTSPRLIKS HLPYRFLPSD LHNGDSKVIY MARNPKDLVV SYYQFHRSLR
160 170 180 190 200
TMSYRGTFQE FCRRFMNDKL GYGSWFEHVQ EFWEHRMDSN VLFLKYEDMH
210 220 230 240 250
RDLVTMVEQL ARFLGVSCDK AQLEALTEHC HQLVDQCCNA EALPVGRGRV
260 270 280
GLWKDIFTVS MNEKFDLVYK QKMGKCDLTF DFYL
Length:284
Mass (Da):33,085
Last modified:August 2, 2002 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iA6EA6844B66C400B
GO
Isoform 2 (identifier: Q9BR01-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     248-284: GRVGLWKDIFTVSMNEKFDLVYKQKMGKCDLTFDFYL → AHCVFARKIFLSW

Show »
Length:260
Mass (Da):30,226
Checksum:i7F71F2C8A264D34F
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
F8WE22F8WE22_HUMAN
Sulfotransferase 4A1
SULT4A1
75Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti55 – 56KS → P in AAH30665 (PubMed:15489334).Curated2
Sequence conflicti239N → S in AAH22459 (PubMed:15489334).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_006304248 – 284GRVGL…FDFYL → AHCVFARKIFLSW in isoform 2. 2 PublicationsAdd BLAST37

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF188698 mRNA Translation: AAF61197.1
AF115311 mRNA Translation: AAF21970.1
AF176342 mRNA Translation: AAK64595.1
AF251263 mRNA Translation: AAF98152.1
AL590119 mRNA Translation: CAC34872.1
CR456588 mRNA Translation: CAG30474.1
AK313048 mRNA Translation: BAG35880.1
Z97055 Genomic DNA No translation available.
CH471138 Genomic DNA Translation: EAW73320.1
BC022459 mRNA Translation: AAH22459.1
BC028171 mRNA Translation: AAH28171.1
BC030665 mRNA Translation: AAH30665.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS14051.1 [Q9BR01-1]

NCBI Reference Sequences

More...
RefSeqi
NP_055166.1, NM_014351.3 [Q9BR01-1]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.189810

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000330884; ENSP00000332565; ENSG00000130540 [Q9BR01-1]
ENST00000422525; ENSP00000388285; ENSG00000130540 [Q9BR01-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
25830

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:25830

UCSC genome browser

More...
UCSCi
uc003bee.2 human [Q9BR01-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF188698 mRNA Translation: AAF61197.1
AF115311 mRNA Translation: AAF21970.1
AF176342 mRNA Translation: AAK64595.1
AF251263 mRNA Translation: AAF98152.1
AL590119 mRNA Translation: CAC34872.1
CR456588 mRNA Translation: CAG30474.1
AK313048 mRNA Translation: BAG35880.1
Z97055 Genomic DNA No translation available.
CH471138 Genomic DNA Translation: EAW73320.1
BC022459 mRNA Translation: AAH22459.1
BC028171 mRNA Translation: AAH28171.1
BC030665 mRNA Translation: AAH30665.1
CCDSiCCDS14051.1 [Q9BR01-1]
RefSeqiNP_055166.1, NM_014351.3 [Q9BR01-1]
UniGeneiHs.189810

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1ZD1X-ray2.24A/B1-284[»]
ProteinModelPortaliQ9BR01
SMRiQ9BR01
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi117358, 10 interactors
IntActiQ9BR01, 5 interactors
MINTiQ9BR01
STRINGi9606.ENSP00000332565

Chemistry databases

ChEMBLiCHEMBL1743298

PTM databases

iPTMnetiQ9BR01
PhosphoSitePlusiQ9BR01

Polymorphism and mutation databases

BioMutaiSULT4A1
DMDMi22096149

Proteomic databases

PaxDbiQ9BR01
PeptideAtlasiQ9BR01
PRIDEiQ9BR01
ProteomicsDBi78733
78734 [Q9BR01-2]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
25830
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000330884; ENSP00000332565; ENSG00000130540 [Q9BR01-1]
ENST00000422525; ENSP00000388285; ENSG00000130540 [Q9BR01-2]
GeneIDi25830
KEGGihsa:25830
UCSCiuc003bee.2 human [Q9BR01-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
25830
DisGeNETi25830
EuPathDBiHostDB:ENSG00000130540.13

GeneCards: human genes, protein and diseases

More...
GeneCardsi
SULT4A1
HGNCiHGNC:14903 SULT4A1
HPAiHPA003129
MIMi608359 gene
neXtProtiNX_Q9BR01
OpenTargetsiENSG00000130540
PharmGKBiPA412

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG1584 Eukaryota
ENOG4111H56 LUCA
GeneTreeiENSGT00940000158662
HOGENOMiHOG000037209
HOVERGENiHBG105932
InParanoidiQ9BR01
KOiK11823
OMAiMVEHCHQ
OrthoDBiEOG091G0D5F
PhylomeDBiQ9BR01
TreeFamiTF321745

Enzyme and pathway databases

BRENDAi2.8.2.1 2681
ReactomeiR-HSA-156584 Cytosolic sulfonation of small molecules
SIGNORiQ9BR01

Miscellaneous databases

EvolutionaryTraceiQ9BR01

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
SULT4A1

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
25830

Protein Ontology

More...
PROi
PR:Q9BR01

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000130540 Expressed in 130 organ(s), highest expression level in anterior cingulate cortex
CleanExiHS_SULT4A1
ExpressionAtlasiQ9BR01 baseline and differential
GenevisibleiQ9BR01 HS

Family and domain databases

InterProiView protein in InterPro
IPR027417 P-loop_NTPase
IPR000863 Sulfotransferase_dom
PfamiView protein in Pfam
PF00685 Sulfotransfer_1, 1 hit
SUPFAMiSSF52540 SSF52540, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiST4A1_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9BR01
Secondary accession number(s): B2R7N3, O43728
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: August 2, 2002
Last sequence update: August 2, 2002
Last modified: December 5, 2018
This is version 147 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. SIMILARITY comments
    Index of protein domains and families
  3. Human chromosome 22
    Human chromosome 22: entries, gene names and cross-references to MIM
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again