Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Sulfotransferase 4A1

Gene

SULT4A1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Atypical sulfotransferase family member with very low affinity for 3'-phospho-5'-adenylyl sulfate (PAPS) and very low catalytic activity towards L-triiodothyronine, thyroxine, estrone, p-nitrophenol, 2-naphthylamine, and 2-beta-naphthol. May have a role in the metabolism of drugs and neurotransmitters in the CNS.1 Publication

GO - Molecular functioni

  • aryl sulfotransferase activity Source: Reactome
  • identical protein binding Source: IntAct
  • sulfotransferase activity Source: UniProtKB

GO - Biological processi

Keywordsi

Molecular functionTransferase
Biological processLipid metabolism, Steroid metabolism

Enzyme and pathway databases

BRENDAi2.8.2.1 2681
ReactomeiR-HSA-156584 Cytosolic sulfonation of small molecules
SIGNORiQ9BR01

Names & Taxonomyi

Protein namesi
Recommended name:
Sulfotransferase 4A1 (EC:2.8.2.-)
Short name:
ST4A1
Alternative name(s):
Brain sulfotransferase-like protein
Short name:
hBR-STL
Short name:
hBR-STL-1
Nervous system sulfotransferase
Short name:
NST
Gene namesi
Name:SULT4A1
Synonyms:SULTX3
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 22

Organism-specific databases

EuPathDBiHostDB:ENSG00000130540.13
HGNCiHGNC:14903 SULT4A1
MIMi608359 gene
neXtProtiNX_Q9BR01

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm

Pathology & Biotechi

Organism-specific databases

DisGeNETi25830
OpenTargetsiENSG00000130540
PharmGKBiPA412

Chemistry databases

ChEMBLiCHEMBL1743298

Polymorphism and mutation databases

BioMutaiSULT4A1
DMDMi22096149

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000851671 – 284Sulfotransferase 4A1Add BLAST284

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei8PhosphothreonineBy similarity1
Modified residuei11PhosphothreonineBy similarity1
Modified residuei205PhosphothreonineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDbiQ9BR01
PeptideAtlasiQ9BR01
PRIDEiQ9BR01
ProteomicsDBi78733
78734 [Q9BR01-2]

PTM databases

iPTMnetiQ9BR01
PhosphoSitePlusiQ9BR01

Expressioni

Tissue specificityi

Highly expressed in the cerebral cortex and frontal lobe, slightly less in the cerebellum, occipital and temporal lobes, relatively low in the medulla and putamen, and lowest in the spinal cord. No expression detected in the pancreas (PubMed:10698717). Highly expressed in fetal brain and occipital lobe, slightly less in the whole brain, frontal lobe, hippocampus, and lung, very low expression in cerebellum, medulla oblongata, temporal lobe, testis, kidney and appendix (PubMed:12039030).2 Publications

Gene expression databases

BgeeiENSG00000130540 Expressed in 130 organ(s), highest expression level in anterior cingulate cortex
CleanExiHS_SULT4A1
ExpressionAtlasiQ9BR01 baseline and differential
GenevisibleiQ9BR01 HS

Organism-specific databases

HPAiHPA003129

Interactioni

Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

BioGridi117358, 10 interactors
IntActiQ9BR01, 5 interactors
MINTiQ9BR01
STRINGi9606.ENSP00000332565

Structurei

Secondary structure

1284
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

ProteinModelPortaliQ9BR01
SMRiQ9BR01
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ9BR01

Family & Domainsi

Sequence similaritiesi

Belongs to the sulfotransferase 1 family.Curated

Phylogenomic databases

eggNOGiKOG1584 Eukaryota
ENOG4111H56 LUCA
GeneTreeiENSGT00900000140912
HOGENOMiHOG000037209
HOVERGENiHBG105932
InParanoidiQ9BR01
KOiK11823
OMAiMVEHCHQ
OrthoDBiEOG091G0D5F
PhylomeDBiQ9BR01
TreeFamiTF321745

Family and domain databases

InterProiView protein in InterPro
IPR027417 P-loop_NTPase
IPR000863 Sulfotransferase_dom
PfamiView protein in Pfam
PF00685 Sulfotransfer_1, 1 hit
SUPFAMiSSF52540 SSF52540, 1 hit

Sequences (2+)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 1 potential isoform that is computationally mapped.iShow all

Isoform 1 (identifier: Q9BR01-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAESEAETPS TPGEFESKYF EFHGVRLPPF CRGKMEEIAN FPVRPSDVWI
60 70 80 90 100
VTYPKSGTSL LQEVVYLVSQ GADPDEIGLM NIDEQLPVLE YPQPGLDIIK
110 120 130 140 150
ELTSPRLIKS HLPYRFLPSD LHNGDSKVIY MARNPKDLVV SYYQFHRSLR
160 170 180 190 200
TMSYRGTFQE FCRRFMNDKL GYGSWFEHVQ EFWEHRMDSN VLFLKYEDMH
210 220 230 240 250
RDLVTMVEQL ARFLGVSCDK AQLEALTEHC HQLVDQCCNA EALPVGRGRV
260 270 280
GLWKDIFTVS MNEKFDLVYK QKMGKCDLTF DFYL
Length:284
Mass (Da):33,085
Last modified:August 2, 2002 - v2
Checksum:iA6EA6844B66C400B
GO
Isoform 2 (identifier: Q9BR01-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     248-284: GRVGLWKDIFTVSMNEKFDLVYKQKMGKCDLTFDFYL → AHCVFARKIFLSW

Show »
Length:260
Mass (Da):30,226
Checksum:i7F71F2C8A264D34F
GO

Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
F8WE22F8WE22_HUMAN
Sulfotransferase 4A1
SULT4A1
75Annotation score:

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti55 – 56KS → P in AAH30665 (PubMed:15489334).Curated2
Sequence conflicti239N → S in AAH22459 (PubMed:15489334).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_006304248 – 284GRVGL…FDFYL → AHCVFARKIFLSW in isoform 2. 2 PublicationsAdd BLAST37

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF188698 mRNA Translation: AAF61197.1
AF115311 mRNA Translation: AAF21970.1
AF176342 mRNA Translation: AAK64595.1
AF251263 mRNA Translation: AAF98152.1
AL590119 mRNA Translation: CAC34872.1
CR456588 mRNA Translation: CAG30474.1
AK313048 mRNA Translation: BAG35880.1
Z97055 Genomic DNA No translation available.
CH471138 Genomic DNA Translation: EAW73320.1
BC022459 mRNA Translation: AAH22459.1
BC028171 mRNA Translation: AAH28171.1
BC030665 mRNA Translation: AAH30665.1
CCDSiCCDS14051.1 [Q9BR01-1]
RefSeqiNP_055166.1, NM_014351.3 [Q9BR01-1]
UniGeneiHs.189810

Genome annotation databases

EnsembliENST00000330884; ENSP00000332565; ENSG00000130540 [Q9BR01-1]
ENST00000422525; ENSP00000388285; ENSG00000130540 [Q9BR01-2]
GeneIDi25830
KEGGihsa:25830
UCSCiuc003bee.2 human [Q9BR01-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiST4A1_HUMAN
AccessioniPrimary (citable) accession number: Q9BR01
Secondary accession number(s): B2R7N3, O43728
Entry historyiIntegrated into UniProtKB/Swiss-Prot: August 2, 2002
Last sequence update: August 2, 2002
Last modified: September 12, 2018
This is version 146 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again