Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - Q9BQW3 (COE4_HUMAN)

Entry version 153 (17 Jun 2020)
Sequence version 2 (10 Jul 2007)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Transcription factor COE4

Gene

EBF4

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:4 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Transcriptional factor which recognizes variations of the palindromic sequence 5'-ATTCCCNNGGGAATT-3'.By similarity

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section specifies the position(s) and type(s) of zinc fingers within the protein.<p><a href='/help/zn_fing' target='_top'>More...</a></p>Zinc fingeri152 – 171C5-typeSequence analysisAdd BLAST20

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionActivator, Developmental protein, DNA-binding
Biological processTranscription, Transcription regulation
LigandMetal-binding, Zinc

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Transcription factor COE4
Alternative name(s):
Early B-cell factor 4
Short name:
EBF-4
Olf-1/EBF-like 4
Short name:
O/E-4
Short name:
OE-4
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:EBF4
Synonyms:COE4, KIAA1442
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 20

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...EuPathDBi		HostDB:ENSG00000088881.20

Human Gene Nomenclature Database

More...HGNCi		HGNC:29278 EBF4

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		609935 gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_Q9BQW3

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

Open Targets

More...OpenTargetsi		ENSG00000088881

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA162384262

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		Q9BQW3 Tbio

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		EBF4

Domain mapping of disease mutations (DMDM)

More...DMDMi		152031576

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001078351 – 602Transcription factor COE4Add BLAST602

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		Q9BQW3

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		Q9BQW3

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q9BQW3

PeptideAtlas

More...PeptideAtlasi		Q9BQW3

PRoteomics IDEntifications database

More...PRIDEi		Q9BQW3

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		78725 [Q9BQW3-2]
78726 [Q9BQW3-1]

Consortium for Top Down Proteomics

More...TopDownProteomicsi		Q9BQW3-1 [Q9BQW3-1]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q9BQW3

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q9BQW3

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000088881 Expressed in myometrium and 159 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		Q9BQW3 baseline and differential

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000088881 Low tissue specificity

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Forms either a homodimer or a heterodimer with a related family member.

By similarity

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection describes interesting single amino acid sites on the sequence that are not defined in any other subsection. This subsection can be displayed in different sections ('Function', 'PTM / Processing', 'Pathology and Biotech') according to its content.<p><a href='/help/site' target='_top'>More...</a></p>Sitei164Interaction with DNABy similarity1
Sitei173Interaction with DNABy similarity1

GO - Molecular functioni

Complete GO annotation on QuickGO ...

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		121644, 3 interactors

Protein interaction database and analysis system

More...IntActi		Q9BQW3, 1 interactor

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000370022

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		Q9BQW3 protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		Q9BQW3

Database of comparative protein structure models

More...ModBasei		Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini256 – 338IPT/TIGAdd BLAST83

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni64 – 67Interaction with DNABy similarity4
Regioni198 – 205Interaction with DNABy similarity8
Regioni237 – 240Interaction with DNABy similarity4

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the COE family.Curated

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri152 – 171C5-typeSequence analysisAdd BLAST20

Keywords - Domaini

Zinc-finger

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG3836 Eukaryota
ENOG410XQ9Z LUCA

Ensembl GeneTree

More...GeneTreei		ENSGT00950000182859

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q9BQW3

KEGG Orthology (KO)

More...KOi		K09103

Database of Orthologous Groups

More...OrthoDBi		817293at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q9BQW3

Family and domain databases

Conserved Domains Database

More...CDDi		cd11606 COE_DBD, 1 hit
cd01175 IPT_COE, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...Gene3Di		2.60.40.10, 1 hit
2.60.40.3180, 1 hit
4.10.280.10, 2 hits

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR032200 COE_DBD
IPR038173 COE_DBD_sf
IPR032201 COE_HLH
IPR038006 COE_IPT
IPR036638 HLH_DNA-bd_sf
IPR013783 Ig-like_fold
IPR014756 Ig_E-set
IPR002909 IPT_dom
IPR003523 Transcription_factor_COE
IPR018350 Transcription_factor_COE_CS

The PANTHER Classification System

More...PANTHERi		PTHR10747 PTHR10747, 1 hit

Pfam protein domain database

More...Pfami		View protein in Pfam
PF16422 COE1_DBD, 1 hit
PF16423 COE1_HLH, 1 hit
PF01833 TIG, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00429 IPT, 1 hit

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF81296 SSF81296, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS01345 COE, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 4 potential isoforms that are computationally mapped.Show allAlign All

Isoform 2 (identifier: Q9BQW3-2) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MFPAQDALPR SGLNLKEEPL LPAGLGSVRS WMQGAGILDA STAAQSGVGL 
        60         70         80         90        100
ARAHFEKQPP SNLRKSNFFH FVLAMYDRQG QPVEVERTAF IDFVEKDREP 
       110        120        130        140        150
GAEKTNNGIH YRLRLVYNNG LRTEQDLYVR LIDSMSKQAI IYEGQDKNPE 
       160        170        180        190        200
MCRVLLTHEI MCSRCCDRKS CGNRNETPSD PVIIDRFFLK FFLKCNQNCL 
       210        220        230        240        250
KNAGNPRDMR RFQVVVSTTV SVDGHVLAVS DNMFVHNNSK HGRRARRLDP 
       260        270        280        290        300
SEAATPCIKA ISPGEGWTTG GATVIVIGDN FFDGLQVVFG NVLVWSELIT 
       310        320        330        340        350
PHAIRVQTPP RHIPGVVEVT LSYKSKQFCK GCPGRFVYTA LNEPTIDYGF 
       360        370        380        390        400
QRLQKVIPRH PGDPERLPKE VLLKRAADLA EALYGVPGSN QELLLKRAAD 
       410        420        430        440        450
VAEALYSTPR APGPLAPLAP SHPHPAVVGI NAFSSPLAIA VGDATPGPEP 
       460        470        480        490        500
GYARSCSSAS PRGFAPSPGS QQSGYGGGLG AGLGGYGAPG VAGLGVPGSP 
       510        520        530        540        550
SFLNGSTATS PFAIMPSSPP LAAASSMSLP AAAPTTSVFS FSPVNMISAV 
       560        570        580        590        600
KQRSAFAPVL RPPSSPPQAC PRAHGEGLPD QSFEDSDKFH SPARGLQGLA 

YS
Length:602
Mass (Da):64,473
Last modified:July 10, 2007 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iEA340606A71094C1
GO
Isoform 1 (identifier: Q9BQW3-1) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-5: MFPAQ → MARARGQAPG...SAPAASASRM
     514-602: IMPSSPPLAA...ARGLQGLAYS → KERLRPRAAPPKLPTPGLPQSPRRGASRPVF

Show »
Length:642
Mass (Da):68,232
Checksum:i18C0BE24442AFA76
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 4 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E9PEI2E9PEI2_HUMAN
Transcription factor COE4
EBF4
598Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
X6R549X6R549_HUMAN
Transcription factor COE4
EBF4
621Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0A0MSW2A0A0A0MSW2_HUMAN
Transcription factor COE4
EBF4
540Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
V9GYU8V9GYU8_HUMAN
Transcription factor COE4
EBF4
177Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti425P → S in BAA92680 (PubMed:10718198).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0264691 – 5MFPAQ → MARARGQAPGSGGRRRPRRG GAGTGPRGESAGLLLLLLQV LPPGATAGPGRRGTRGAGGG GVCWPGAAPAFPRDARLLLL LPPLPPLSPPPPSSAPAASA SRM in isoform 1. 1 Publication5
Alternative sequenceiVSP_026470514 – 602IMPSS…GLAYS → KERLRPRAAPPKLPTPGLPQ SPRRGASRPVF in isoform 1. 1 PublicationAdd BLAST89

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AL035460 Genomic DNA No translation available.
AB037863 mRNA Translation: BAA92680.1

NCBI Reference Sequences

More...RefSeqi		NP_001103984.1, NM_001110514.1

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000609451; ENSP00000477023; ENSG00000088881 [Q9BQW3-2]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		57593

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:57593

UCSC genome browser

More...UCSCi		uc061vby.1 human [Q9BQW3-2]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AL035460 Genomic DNA No translation available.
AB037863 mRNA Translation: BAA92680.1
RefSeqiNP_001103984.1, NM_001110514.1

3D structure databases

SMRiQ9BQW3
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi121644, 3 interactors
IntActiQ9BQW3, 1 interactor
STRINGi9606.ENSP00000370022

PTM databases

iPTMnetiQ9BQW3
PhosphoSitePlusiQ9BQW3

Polymorphism and mutation databases

BioMutaiEBF4
DMDMi152031576

Proteomic databases

jPOSTiQ9BQW3
MassIVEiQ9BQW3
PaxDbiQ9BQW3
PeptideAtlasiQ9BQW3
PRIDEiQ9BQW3
ProteomicsDBi78725 [Q9BQW3-2]
78726 [Q9BQW3-1]
TopDownProteomicsiQ9BQW3-1 [Q9BQW3-1]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		23277 84 antibodies

Genome annotation databases

EnsembliENST00000609451; ENSP00000477023; ENSG00000088881 [Q9BQW3-2]
GeneIDi57593
KEGGihsa:57593
UCSCiuc061vby.1 human [Q9BQW3-2]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		57593
EuPathDBiHostDB:ENSG00000088881.20

GeneCards: human genes, protein and diseases

More...GeneCardsi		EBF4
HGNCiHGNC:29278 EBF4
HPAiENSG00000088881 Low tissue specificity
MIMi609935 gene
neXtProtiNX_Q9BQW3
OpenTargetsiENSG00000088881
PharmGKBiPA162384262

Human Unidentified Gene-Encoded large proteins database

More...HUGEi		Search...

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG3836 Eukaryota
ENOG410XQ9Z LUCA
GeneTreeiENSGT00950000182859
InParanoidiQ9BQW3
KOiK09103
OrthoDBi817293at2759
PhylomeDBiQ9BQW3

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		57593 6 hits in 810 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		EBF4 human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		57593
PharosiQ9BQW3 Tbio

Protein Ontology

More...PROi		PR:Q9BQW3
RNActiQ9BQW3 protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000088881 Expressed in myometrium and 159 other tissues
ExpressionAtlasiQ9BQW3 baseline and differential

Family and domain databases

CDDicd11606 COE_DBD, 1 hit
cd01175 IPT_COE, 1 hit
Gene3Di2.60.40.10, 1 hit
2.60.40.3180, 1 hit
4.10.280.10, 2 hits
InterProiView protein in InterPro
IPR032200 COE_DBD
IPR038173 COE_DBD_sf
IPR032201 COE_HLH
IPR038006 COE_IPT
IPR036638 HLH_DNA-bd_sf
IPR013783 Ig-like_fold
IPR014756 Ig_E-set
IPR002909 IPT_dom
IPR003523 Transcription_factor_COE
IPR018350 Transcription_factor_COE_CS
PANTHERiPTHR10747 PTHR10747, 1 hit
PfamiView protein in Pfam
PF16422 COE1_DBD, 1 hit
PF16423 COE1_HLH, 1 hit
PF01833 TIG, 1 hit
SMARTiView protein in SMART
SM00429 IPT, 1 hit
SUPFAMiSSF81296 SSF81296, 1 hit
PROSITEiView protein in PROSITE
PS01345 COE, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiCOE4_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9BQW3
Secondary accession number(s): Q1MTP7
, Q5JY53, Q9NUB6, Q9P2A6
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 10, 2002
Last sequence update: July 10, 2007
Last modified: June 17, 2020
This is version 153 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. Human chromosome 20
    Human chromosome 20: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again