Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 149 (18 Sep 2019)
Sequence version 3 (11 Jan 2011)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Synaptotagmin-15

Gene

SYT15

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:4 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

May be involved in the trafficking and exocytosis of secretory vesicles in non-neuronal tissues.By similarity

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Synaptotagmin-15
Alternative name(s):
Chr10Syt
Synaptotagmin XV
Short name:
SytXV
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:SYT15
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 10

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:17167 SYT15

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
608081 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q9BQS2

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini1 – 4ExtracellularBy similarity4
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei5 – 29Helical; Signal-anchor for type III membrane proteinSequence analysisAdd BLAST25
Topological domaini30 – 421CytoplasmicSequence analysisAdd BLAST392

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Cell membrane, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

Open Targets

More...
OpenTargetsi
ENSG00000204176
ENSG00000277758

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA134921618

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q9BQS2

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
SYT15

Domain mapping of disease mutations (DMDM)

More...
DMDMi
317373506

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001839801 – 421Synaptotagmin-15Add BLAST421

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q9BQS2

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q9BQS2

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q9BQS2

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9BQS2

PeptideAtlas

More...
PeptideAtlasi
Q9BQS2

PRoteomics IDEntifications database

More...
PRIDEi
Q9BQS2

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
78711 [Q9BQS2-1]
78712 [Q9BQS2-2]
78713 [Q9BQS2-3]
78714 [Q9BQS2-4]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9BQS2

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9BQS2

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000204176 Expressed in 93 organ(s), highest expression level in prefrontal cortex

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q9BQS2 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9BQS2 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA036971
HPA036972
HPA064559

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Homodimer.

By similarity

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
123765, 2 interactors

Protein interaction database and analysis system

More...
IntActi
Q9BQS2, 6 interactors

Molecular INTeraction database

More...
MINTi
Q9BQS2

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000363441

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q9BQS2

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini149 – 248C2 1PROSITE-ProRule annotationAdd BLAST100
Domaini280 – 383C2 2PROSITE-ProRule annotationAdd BLAST104

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

Neither C2 domains mediates Ca2+-dependent or -independent phospholipid binding.By similarity

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the synaptotagmin family.Curated

Keywords - Domaini

Repeat, Signal-anchor, Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG1028 Eukaryota
ENOG410XRME LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000160819

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000273864

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9BQS2

KEGG Orthology (KO)

More...
KOi
K19914

Database of Orthologous Groups

More...
OrthoDBi
925064at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9BQS2

TreeFam database of animal gene trees

More...
TreeFami
TF315600

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
2.60.40.150, 2 hits

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR000008 C2_dom
IPR035892 C2_domain_sf
IPR030539 SYT15

The PANTHER Classification System

More...
PANTHERi
PTHR10024:SF234 PTHR10024:SF234, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00168 C2, 2 hits

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00239 C2, 2 hits

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50004 C2, 2 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 4 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9BQS2-1) [UniParc]FASTAAdd to basket
Also known as: Syt XV-a

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAEQLALVIG GTIGGLLLLL LIGASCCLWR RFCATLTYEE LPGTPAMATT
60 70 80 90 100
AASSGQRDRP CQPHARTQLS RPPAVPFVVP PTLQGRDWVP LHSGEWADAP
110 120 130 140 150
WDPCPASELL PHTSSGGLGD ACMVGAINPE LYKFPEDKSE TDFPDGCLGR
160 170 180 190 200
LWFSVEYEQE AERLLVGLIK AQHLQAPSET CSPLVKLYLL PDERRFLQSK
210 220 230 240 250
TKRKTSNPQF DEHFIFQVSS KTITQRVLKF SVYHVDRQRK HQLLGQVLFP
260 270 280 290 300
LKNETLVGDC RRVIWRDLEA ESLEPPSEFG DLQFCLSYND YLSRLTVVVL
310 320 330 340 350
RAKGLRLQED RGIVSVFVKV SLMNHNKFVK CKKTSAVLGS INPVYNETFS
360 370 380 390 400
FKADATELDT ASLSLTVVQN MEGDKSQQLG RVVVGPYMYT RGRELEHWDE
410 420
MLSKPKELVK RWHALCRTTE P
Length:421
Mass (Da):47,375
Last modified:January 11, 2011 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iAD9C6CE0957625B7
GO
Isoform 2 (identifier: Q9BQS2-2) [UniParc]FASTAAdd to basket
Also known as: Syt XV-b

The sequence of this isoform differs from the canonical sequence as follows:
     376-421: SQQLGRVVVGPYMYTRGRELEHWDEMLSKPKELVKRWHALCRTTEP → QATTVELFLFHLTSG

Show »
Length:390
Mass (Da):43,527
Checksum:i5FB475F7AAD147F6
GO
Isoform 3 (identifier: Q9BQS2-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-71: MAEQLALVIG...QPHARTQLSR → MGVVLLPHPA...TSLREQPHGG

Show »
Length:474
Mass (Da):52,239
Checksum:i628723D4D558B350
GO
Isoform 4 (identifier: Q9BQS2-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     333-348: KTSAVLGSINPVYNET → PGPGLGEESRGSLNLK
     349-421: Missing.

Show »
Length:348
Mass (Da):38,899
Checksum:iF39977352580FEC8
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 4 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A096LNH4A0A096LNH4_HUMAN
Uncharacterized protein
LOC102724488
444Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
X6R8R1X6R8R1_HUMAN
Synaptotagmin-15
SYT15 LOC102724488
474Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D6RF99D6RF99_HUMAN
Synaptotagmin-15
SYT15
136Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H3BLX3H3BLX3_HUMAN
Synaptotagmin-15
SYT15
180Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti246Q → R in BAC85479 (PubMed:14702039).Curated1
Sequence conflicti309E → D in BAC76817 (PubMed:12788067).Curated1
Sequence conflicti309E → D in BAC76818 (PubMed:12788067).Curated1
Sequence conflicti309E → D in BAC86979 (PubMed:14702039).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0086431 – 71MAEQL…TQLSR → MGVVLLPHPAPSRREPLAPL APGTRPGWSPAVSGSSRSAL RPSTAGPGPGPGTGWGGTAA SGRWVPAPAVHCAAPRAAAG HQQHHGPPLCSPDGAPRRFK RRPGSPAPAAQTGETSLREQ PHGG in isoform 3. 1 PublicationAdd BLAST71
Alternative sequenceiVSP_008644333 – 348KTSAV…VYNET → PGPGLGEESRGSLNLK in isoform 4. 1 PublicationAdd BLAST16
Alternative sequenceiVSP_008645349 – 421Missing in isoform 4. 1 PublicationAdd BLAST73
Alternative sequenceiVSP_008646376 – 421SQQLG…RTTEP → QATTVELFLFHLTSG in isoform 2. 2 PublicationsAdd BLAST46

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AB109022 mRNA Translation: BAC76817.1
AB109023 mRNA Translation: BAC76818.1
AK127436 mRNA Translation: BAC86979.1
AK131036 mRNA Translation: BAC85479.1
AL356056 Genomic DNA No translation available.
BC139914 mRNA Translation: AAI39915.1
AJ303363 mRNA Translation: CAC33885.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS73103.1 [Q9BQS2-1]
CCDS73104.1 [Q9BQS2-2]

NCBI Reference Sequences

More...
RefSeqi
NP_114118.2, NM_031912.4 [Q9BQS2-1]
NP_852660.1, NM_181519.2 [Q9BQS2-2]
XP_006718074.1, XM_006718011.1 [Q9BQS2-2]
XP_006718160.1, XM_006718097.3 [Q9BQS2-2]
XP_016872240.1, XM_017016751.1 [Q9BQS2-2]
XP_016872241.1, XM_017016752.1 [Q9BQS2-2]
XP_016872510.1, XM_017017021.1
XP_016872512.1, XM_017017023.1 [Q9BQS2-2]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000374321; ENSP00000363441; ENSG00000204176 [Q9BQS2-1]
ENST00000503753; ENSP00000427607; ENSG00000204176 [Q9BQS2-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
102724488
83849

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:83849

UCSC genome browser

More...
UCSCi
uc001jea.4 human [Q9BQS2-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB109022 mRNA Translation: BAC76817.1
AB109023 mRNA Translation: BAC76818.1
AK127436 mRNA Translation: BAC86979.1
AK131036 mRNA Translation: BAC85479.1
AL356056 Genomic DNA No translation available.
BC139914 mRNA Translation: AAI39915.1
AJ303363 mRNA Translation: CAC33885.1
CCDSiCCDS73103.1 [Q9BQS2-1]
CCDS73104.1 [Q9BQS2-2]
RefSeqiNP_114118.2, NM_031912.4 [Q9BQS2-1]
NP_852660.1, NM_181519.2 [Q9BQS2-2]
XP_006718074.1, XM_006718011.1 [Q9BQS2-2]
XP_006718160.1, XM_006718097.3 [Q9BQS2-2]
XP_016872240.1, XM_017016751.1 [Q9BQS2-2]
XP_016872241.1, XM_017016752.1 [Q9BQS2-2]
XP_016872510.1, XM_017017021.1
XP_016872512.1, XM_017017023.1 [Q9BQS2-2]

3D structure databases

SMRiQ9BQS2
ModBaseiSearch...

Protein-protein interaction databases

BioGridi123765, 2 interactors
IntActiQ9BQS2, 6 interactors
MINTiQ9BQS2
STRINGi9606.ENSP00000363441

PTM databases

iPTMnetiQ9BQS2
PhosphoSitePlusiQ9BQS2

Polymorphism and mutation databases

BioMutaiSYT15
DMDMi317373506

Proteomic databases

jPOSTiQ9BQS2
MassIVEiQ9BQS2
MaxQBiQ9BQS2
PaxDbiQ9BQS2
PeptideAtlasiQ9BQS2
PRIDEiQ9BQS2
ProteomicsDBi78711 [Q9BQS2-1]
78712 [Q9BQS2-2]
78713 [Q9BQS2-3]
78714 [Q9BQS2-4]

Genome annotation databases

EnsembliENST00000374321; ENSP00000363441; ENSG00000204176 [Q9BQS2-1]
ENST00000503753; ENSP00000427607; ENSG00000204176 [Q9BQS2-2]
GeneIDi102724488
83849
KEGGihsa:83849
UCSCiuc001jea.4 human [Q9BQS2-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
83849

GeneCards: human genes, protein and diseases

More...
GeneCardsi
SYT15
HGNCiHGNC:17167 SYT15
HPAiHPA036971
HPA036972
HPA064559
MIMi608081 gene
neXtProtiNX_Q9BQS2
OpenTargetsiENSG00000204176
ENSG00000277758
PharmGKBiPA134921618

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG1028 Eukaryota
ENOG410XRME LUCA
GeneTreeiENSGT00940000160819
HOGENOMiHOG000273864
InParanoidiQ9BQS2
KOiK19914
OrthoDBi925064at2759
PhylomeDBiQ9BQS2
TreeFamiTF315600

Miscellaneous databases

PharosiQ9BQS2

Protein Ontology

More...
PROi
PR:Q9BQS2

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000204176 Expressed in 93 organ(s), highest expression level in prefrontal cortex
ExpressionAtlasiQ9BQS2 baseline and differential
GenevisibleiQ9BQS2 HS

Family and domain databases

Gene3Di2.60.40.150, 2 hits
InterProiView protein in InterPro
IPR000008 C2_dom
IPR035892 C2_domain_sf
IPR030539 SYT15
PANTHERiPTHR10024:SF234 PTHR10024:SF234, 1 hit
PfamiView protein in Pfam
PF00168 C2, 2 hits
SMARTiView protein in SMART
SM00239 C2, 2 hits
PROSITEiView protein in PROSITE
PS50004 C2, 2 hits

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiSYT15_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9BQS2
Secondary accession number(s): A5D6W8
, Q5VY53, Q5VY55, Q7Z439, Q7Z440
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 24, 2003
Last sequence update: January 11, 2011
Last modified: September 18, 2019
This is version 149 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 10
    Human chromosome 10: entries, gene names and cross-references to MIM
  2. SIMILARITY comments
    Index of protein domains and families
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again