Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

SMC5-SMC6 complex localization factor protein 1

Gene

SLF1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Plays a role in the DNA damage response (DDR) pathway by regulating postreplication repair of UV-damaged DNA and genomic stability maintenance (PubMed:25931565). The SLF1-SLF2 complex acts to link RAD18 with the SMC5-SMC6 complex at replication-coupled interstrand cross-links (ICL) and DNA double-strand breaks (DSBs) sites on chromatin during DNA repair in response to stalled replication forks (PubMed:25931565). Promotes the recruitment of SLF2 and the SMC5-SMC6 complex to DNA lesions (PubMed:25931565).1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • protein-containing complex binding Source: UniProtKB
  • ubiquitin protein ligase binding Source: UniProtKB

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processDNA damage, DNA repair

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
SMC5-SMC6 complex localization factor protein 1Imported
Alternative name(s):
Ankyrin repeat domain-containing protein 32
BRCT domain-containing protein 1
Smc5/6 localization factor 11 Publication
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:SLF11 PublicationImported
Synonyms:ANKRD32, BRCTD1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 5

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000133302.12

Human Gene Nomenclature Database

More...
HGNCi
HGNC:25408 SLF1

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q9BQI6

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Cytoskeleton, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

Open Targets

More...
OpenTargetsi
ENSG00000133302

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA134911523

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
SLF1

Domain mapping of disease mutations (DMDM)

More...
DMDMi
193806371

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002439061 – 1058SMC5-SMC6 complex localization factor protein 1Add BLAST1058

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section describes <strong>covalent linkages</strong> of various types formed <strong>between two proteins (interchain cross-links)</strong> or <strong>between two parts of the same protein (intrachain cross-links)</strong>, except the disulfide bonds that are annotated in the <a href="http://www.uniprot.org/manual/disulfid">'Disulfide bond'</a> subsection.<p><a href='/help/crosslnk' target='_top'>More...</a></p>Cross-linki931Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources

Keywords - PTMi

Isopeptide bond, Ubl conjugation

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q9BQI6

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q9BQI6

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q9BQI6

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9BQI6

PeptideAtlas

More...
PeptideAtlasi
Q9BQI6

PRoteomics IDEntifications database

More...
PRIDEi
Q9BQI6

ProteomicsDB human proteome resource

More...
ProteomicsDBi
78690

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9BQI6

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9BQI6

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000133302 Expressed in 171 organ(s), highest expression level in frontal cortex

CleanEx database of gene expression profiles

More...
CleanExi
HS_ANKRD32

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q9BQI6 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9BQI6 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA040793
HPA054213

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts (via N-terminus) with SLF2; this interaction links RAD18 to the SMC5-SMC6 complex (PubMed:25931565). Interacts (via BRCT domains) with RAD18; this interaction occurs in a SLF2-independent manner (PubMed:25931565). Interacts with SMC6 (PubMed:25931565). Interacts (via BRCT domains) with RAD18 (via C-terminus and phosphorylated form); this interaction is required for efficient repair of UV-induced DNA damage (By similarity).By similarity1 Publication

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
123978, 8 interactors

Protein interaction database and analysis system

More...
IntActi
Q9BQI6, 6 interactors

Molecular INTeraction database

More...
MINTi
Q9BQI6

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000265140

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
Q9BQI6

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini12 – 77BRCT 1Add BLAST66
Domaini119 – 196BRCT 2Add BLAST78
<p>This subsection of the ‘Family and Domains’ section indicates the positions and types of repeated sequence motifs or repeated domains within the protein.<p><a href='/help/repeat' target='_top'>More...</a></p>Repeati806 – 836ANK 1Add BLAST31
Repeati840 – 869ANK 2Add BLAST30
Repeati874 – 903ANK 3Add BLAST30

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

BRCT domains are necessary for its targeting to ionizing radiation-induced nuclear foci.By similarity

Keywords - Domaini

ANK repeat, Repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG0504 Eukaryota
KOG1929 Eukaryota
ENOG410XPFH LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000158953

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000070016

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG103143

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9BQI6

Identification of Orthologs from Complete Genome Data

More...
OMAi
RSCLFNE

Database of Orthologous Groups

More...
OrthoDBi
1003628at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9BQI6

TreeFam database of animal gene trees

More...
TreeFami
TF329705

Family and domain databases

Conserved Domains Database

More...
CDDi
cd00204 ANK, 1 hit
cd00027 BRCT, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.25.40.20, 1 hit
3.40.50.10190, 2 hits

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR002110 Ankyrin_rpt
IPR020683 Ankyrin_rpt-contain_dom
IPR036770 Ankyrin_rpt-contain_sf
IPR001357 BRCT_dom
IPR036420 BRCT_dom_sf

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF12796 Ank_2, 1 hit
PF16770 RTT107_BRCT_5, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00248 ANK, 3 hits
SM00292 BRCT, 2 hits

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF48403 SSF48403, 1 hit
SSF52113 SSF52113, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50297 ANK_REP_REGION, 1 hit
PS50088 ANK_REPEAT, 3 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9BQI6-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MEDGTPKHII QMTGFKMEEK EALVKLLLKL DCTFIKSEKY KNCTHLIAER
60 70 80 90 100
LCKSEKFLAA CAAGKWILTK DYIIHSAKSG RWLDETTYEW GYKIEKDSRY
110 120 130 140 150
SPQMQSAPKR WREELKRTGA PGAFHRWKVV LLVRTDKRSD SLIRVLEAGK
160 170 180 190 200
ANVILPKSSP SGITHVIASN ARIKAEKEKD NFKAPFYPIQ YLGDFLLEKE
210 220 230 240 250
IQNDEDSQTN SVWTEHSNEE TNKDFRKDAG FLEMKGALRE TMYRTQKEMQ
260 270 280 290 300
NHEDVNVGSI LIQHHKKEKF SGSSKDLKFV KMRNTFGSHT YENQKEIKKK
310 320 330 340 350
DEDIQRSYTL RRKRKKGKES NCKKGVEHEK IKSTLRRHIY NRDQKEMKNS
360 370 380 390 400
IFAEYAKESK AMAIKTDVDV VEIKNTLRKH IYRAQAVRYN CIRIDKQPVY
410 420 430 440 450
NVEVKNAEFP RGVLNLIESL IEGHFFKEAI EELSTLQAHY IPPVCVLHAL
460 470 480 490 500
LENVLQDNID TFSGRYFHIL SALLHLHPPW KSPAMSRYYL ELFQCPTCMK
510 520 530 540 550
GAWSLVEVLI RSCLFNESFC HQISENIGSK VLHLTLLKFF FNLIESEVQH
560 570 580 590 600
LSQKLYDWSD SQNLKITGKA MLLEIFWSGS ETSGLLTKPV NMLLEWTIYS
610 620 630 640 650
HKEKFKSNDV FKHELAYLLA GILGAAIDYW IFLGLKMGRN VMRHMSDDLG
660 670 680 690 700
SYVSLSCDDF SSQELEIFIC SFSSSWLQMF VAEAVFKKLC LQSSGSVSSE
710 720 730 740 750
PLSLQKMVYS YLPALGKTGV LGSGKIQVSK KIGQRPCFDS QRTLLMLNGT
760 770 780 790 800
KQKQVEGLPE LLDLNLAKCS SSLKKLKKKS EGELSCSKEN CPSVVKKMNF
810 820 830 840 850
HKTNLKGETA LHRACINNQV EKLILLLSLP GIDINVKDNA GWTPLHEACN
860 870 880 890 900
YGNTVCVQEI LQRCPEVDLL TQVDGVTPLH DALSNGHVEI GKLLLQHGGP
910 920 930 940 950
VLLQQRNAKG ELPLDYVVSP QIKEELFAIT KIEDTVENFH AQAEKHFHYQ
960 970 980 990 1000
QLEFGSFLLS RMLLNFCSIF DLSSEFILAS KGLTHLNELL MACKSHKETT
1010 1020 1030 1040 1050
SVHTDWLLDL YAGNIKTLQK LPHILKELPE NLKVCPGVHT EALMITLEMM

CRSVMEFS
Length:1,058
Mass (Da):121,050
Last modified:July 1, 2008 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iC624008C7CC25FE6
GO
Isoform 2 (identifier: Q9BQI6-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     145-179: VLEAGKANVILPKSSPSGITHVIASNARIKAEKEK → KKFRMMKIPKPILFGLNIAMKKQTKISGKMQDFLK
     180-1058: Missing.

Note: No experimental confirmation available.
Show »
Length:179
Mass (Da):21,003
Checksum:i04B900457E943E18
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
D6RED9D6RED9_HUMAN
SMC5-SMC6 complex localization fact...
SLF1
130Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YBU1H0YBU1_HUMAN
SMC5-SMC6 complex localization fact...
SLF1
129Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAH54885 differs from that shown. Contaminating sequence. Potential poly-A sequence.Curated
The sequence AAH54885 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated
The sequence AAH70332 differs from that shown. Contaminating sequence. Potential poly-A sequence.Curated
The sequence AAH70332 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated
The sequence AAI07572 differs from that shown. Reason: Erroneous initiation.Curated
The sequence CAB66495 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti24V → A in CAB43397 (PubMed:17974005).Curated1
Sequence conflicti103Q → R in CAB43397 (PubMed:17974005).Curated1
Sequence conflicti182F → S in AAH54885 (PubMed:15489334).Curated1
Sequence conflicti221T → A in CAB43397 (PubMed:17974005).Curated1
Sequence conflicti328H → Q in AAH70332 (PubMed:15489334).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_059120288S → R. Corresponds to variant dbSNP:rs6891545Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_056914145 – 179VLEAG…AEKEK → KKFRMMKIPKPILFGLNIAM KKQTKISGKMQDFLK in isoform 2. 1 PublicationAdd BLAST35
Alternative sequenceiVSP_056915180 – 1058Missing in isoform 2. 1 PublicationAdd BLAST879

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AK297452 mRNA Translation: BAG59876.1
AC008534 Genomic DNA No translation available.
AC025766 Genomic DNA No translation available.
BC054885 mRNA Translation: AAH54885.2 Sequence problems.
BC070332 mRNA Translation: AAH70332.1 Sequence problems.
BC107571 mRNA Translation: AAI07572.1 Different initiation.
AL050298 mRNA Translation: CAB43397.2
AL136560 mRNA Translation: CAB66495.1 Different initiation.
CR533539 mRNA Translation: CAG38570.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS4071.2 [Q9BQI6-1]

Protein sequence database of the Protein Information Resource

More...
PIRi
T08704

NCBI Reference Sequences

More...
RefSeqi
NP_115666.2, NM_032290.3 [Q9BQI6-1]
XP_016865468.1, XM_017009979.1 [Q9BQI6-1]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.657315

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000265140; ENSP00000265140; ENSG00000133302 [Q9BQI6-1]
ENST00000508130; ENSP00000424232; ENSG00000133302 [Q9BQI6-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
84250

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:84250

UCSC genome browser

More...
UCSCi
uc003kkr.5 human [Q9BQI6-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK297452 mRNA Translation: BAG59876.1
AC008534 Genomic DNA No translation available.
AC025766 Genomic DNA No translation available.
BC054885 mRNA Translation: AAH54885.2 Sequence problems.
BC070332 mRNA Translation: AAH70332.1 Sequence problems.
BC107571 mRNA Translation: AAI07572.1 Different initiation.
AL050298 mRNA Translation: CAB43397.2
AL136560 mRNA Translation: CAB66495.1 Different initiation.
CR533539 mRNA Translation: CAG38570.1
CCDSiCCDS4071.2 [Q9BQI6-1]
PIRiT08704
RefSeqiNP_115666.2, NM_032290.3 [Q9BQI6-1]
XP_016865468.1, XM_017009979.1 [Q9BQI6-1]
UniGeneiHs.657315

3D structure databases

ProteinModelPortaliQ9BQI6
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi123978, 8 interactors
IntActiQ9BQI6, 6 interactors
MINTiQ9BQI6
STRINGi9606.ENSP00000265140

PTM databases

iPTMnetiQ9BQI6
PhosphoSitePlusiQ9BQI6

Polymorphism and mutation databases

BioMutaiSLF1
DMDMi193806371

Proteomic databases

EPDiQ9BQI6
jPOSTiQ9BQI6
MaxQBiQ9BQI6
PaxDbiQ9BQI6
PeptideAtlasiQ9BQI6
PRIDEiQ9BQI6
ProteomicsDBi78690

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
84250
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000265140; ENSP00000265140; ENSG00000133302 [Q9BQI6-1]
ENST00000508130; ENSP00000424232; ENSG00000133302 [Q9BQI6-2]
GeneIDi84250
KEGGihsa:84250
UCSCiuc003kkr.5 human [Q9BQI6-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
84250
EuPathDBiHostDB:ENSG00000133302.12

GeneCards: human genes, protein and diseases

More...
GeneCardsi
SLF1
HGNCiHGNC:25408 SLF1
HPAiHPA040793
HPA054213
neXtProtiNX_Q9BQI6
OpenTargetsiENSG00000133302
PharmGKBiPA134911523

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG0504 Eukaryota
KOG1929 Eukaryota
ENOG410XPFH LUCA
GeneTreeiENSGT00940000158953
HOGENOMiHOG000070016
HOVERGENiHBG103143
InParanoidiQ9BQI6
OMAiRSCLFNE
OrthoDBi1003628at2759
PhylomeDBiQ9BQI6
TreeFamiTF329705

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
SLF1 human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
84250

Protein Ontology

More...
PROi
PR:Q9BQI6

Gene expression databases

BgeeiENSG00000133302 Expressed in 171 organ(s), highest expression level in frontal cortex
CleanExiHS_ANKRD32
ExpressionAtlasiQ9BQI6 baseline and differential
GenevisibleiQ9BQI6 HS

Family and domain databases

CDDicd00204 ANK, 1 hit
cd00027 BRCT, 1 hit
Gene3Di1.25.40.20, 1 hit
3.40.50.10190, 2 hits
InterProiView protein in InterPro
IPR002110 Ankyrin_rpt
IPR020683 Ankyrin_rpt-contain_dom
IPR036770 Ankyrin_rpt-contain_sf
IPR001357 BRCT_dom
IPR036420 BRCT_dom_sf
PfamiView protein in Pfam
PF12796 Ank_2, 1 hit
PF16770 RTT107_BRCT_5, 1 hit
SMARTiView protein in SMART
SM00248 ANK, 3 hits
SM00292 BRCT, 2 hits
SUPFAMiSSF48403 SSF48403, 1 hit
SSF52113 SSF52113, 1 hit
PROSITEiView protein in PROSITE
PS50297 ANK_REP_REGION, 1 hit
PS50088 ANK_REPEAT, 3 hits

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiSLF1_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9BQI6
Secondary accession number(s): B4DMG4
, Q3B7K4, Q6NSA5, Q6PHW9, Q9Y402
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: June 27, 2006
Last sequence update: July 1, 2008
Last modified: January 16, 2019
This is version 137 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  2. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  3. Human chromosome 5
    Human chromosome 5: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again