Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

SMC5-SMC6 complex localization factor protein 1

Gene

SLF1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Plays a role in the DNA damage response (DDR) pathway by regulating postreplication repair of UV-damaged DNA and genomic stability maintenance (PubMed:25931565). The SLF1-SLF2 complex acts to link RAD18 with the SMC5-SMC6 complex at replication-coupled interstrand cross-links (ICL) and DNA double-strand breaks (DSBs) sites on chromatin during DNA repair in response to stalled replication forks (PubMed:25931565). Promotes the recruitment of SLF2 and the SMC5-SMC6 complex to DNA lesions (PubMed:25931565).1 Publication

GO - Molecular functioni

  • protein-containing complex binding Source: UniProtKB
  • ubiquitin protein ligase binding Source: UniProtKB

GO - Biological processi

  • cellular response to DNA damage stimulus Source: UniProtKB
  • DNA repair Source: UniProtKB-KW
  • positive regulation of double-strand break repair Source: UniProtKB
  • positive regulation of maintenance of mitotic sister chromatid cohesion Source: UniProtKB
  • positive regulation of protein complex assembly Source: UniProtKB
  • protein localization to site of double-strand break Source: UniProtKB

Keywordsi

Biological processDNA damage, DNA repair

Names & Taxonomyi

Protein namesi
Recommended name:
SMC5-SMC6 complex localization factor protein 1Imported
Alternative name(s):
Ankyrin repeat domain-containing protein 32
BRCT domain-containing protein 1
Smc5/6 localization factor 11 Publication
Gene namesi
Name:SLF11 PublicationImported
Synonyms:ANKRD32, BRCTD1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 5

Organism-specific databases

EuPathDBiHostDB:ENSG00000133302.12
HGNCiHGNC:25408 SLF1
neXtProtiNX_Q9BQI6

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Cytoskeleton, Nucleus

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000133302
PharmGKBiPA134911523

Polymorphism and mutation databases

BioMutaiANKRD32
DMDMi193806371

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002439061 – 1058SMC5-SMC6 complex localization factor protein 1Add BLAST1058

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Cross-linki931Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources

Keywords - PTMi

Isopeptide bond, Ubl conjugation

Proteomic databases

EPDiQ9BQI6
MaxQBiQ9BQI6
PaxDbiQ9BQI6
PeptideAtlasiQ9BQI6
PRIDEiQ9BQI6
ProteomicsDBi78690

PTM databases

iPTMnetiQ9BQI6
PhosphoSitePlusiQ9BQI6

Expressioni

Gene expression databases

BgeeiENSG00000133302
CleanExiHS_ANKRD32
ExpressionAtlasiQ9BQI6 baseline and differential
GenevisibleiQ9BQI6 HS

Organism-specific databases

HPAiHPA040793
HPA054213

Interactioni

Subunit structurei

Interacts (via N-terminus) with SLF2; this interaction links RAD18 to the SMC5-SMC6 complex (PubMed:25931565). Interacts (via BRCT domains) with RAD18; this interaction occurs in a SLF2-independent manner (PubMed:25931565). Interacts with SMC6 (PubMed:25931565). Interacts (via BRCT domains) with RAD18 (via C-terminus and phosphorylated form); this interaction is required for efficient repair of UV-induced DNA damage (By similarity).By similarity1 Publication

GO - Molecular functioni

  • ubiquitin protein ligase binding Source: UniProtKB

Protein-protein interaction databases

BioGridi123978, 8 interactors
IntActiQ9BQI6, 5 interactors
MINTiQ9BQI6
STRINGi9606.ENSP00000265140

Structurei

3D structure databases

ProteinModelPortaliQ9BQI6
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini12 – 77BRCT 1Add BLAST66
Domaini119 – 196BRCT 2Add BLAST78
Repeati806 – 836ANK 1Add BLAST31
Repeati840 – 869ANK 2Add BLAST30
Repeati874 – 903ANK 3Add BLAST30

Domaini

BRCT domains are necessary for its targeting to ionizing radiation-induced nuclear foci.By similarity

Keywords - Domaini

ANK repeat, Repeat

Phylogenomic databases

eggNOGiKOG0504 Eukaryota
KOG1929 Eukaryota
ENOG410XPFH LUCA
GeneTreeiENSGT00760000119090
HOGENOMiHOG000033961
HOVERGENiHBG103143
InParanoidiQ9BQI6
OMAiPFYPIQY
OrthoDBiEOG091G0JQ3
PhylomeDBiQ9BQI6
TreeFamiTF329705

Family and domain databases

CDDicd00204 ANK, 1 hit
cd00027 BRCT, 1 hit
Gene3Di1.25.40.20, 1 hit
3.40.50.10190, 2 hits
InterProiView protein in InterPro
IPR002110 Ankyrin_rpt
IPR020683 Ankyrin_rpt-contain_dom
IPR036770 Ankyrin_rpt-contain_sf
IPR001357 BRCT_dom
IPR036420 BRCT_dom_sf
PfamiView protein in Pfam
PF12796 Ank_2, 1 hit
PF16770 RTT107_BRCT_5, 1 hit
SMARTiView protein in SMART
SM00248 ANK, 3 hits
SM00292 BRCT, 2 hits
SUPFAMiSSF48403 SSF48403, 1 hit
SSF52113 SSF52113, 1 hit
PROSITEiView protein in PROSITE
PS50297 ANK_REP_REGION, 1 hit
PS50088 ANK_REPEAT, 3 hits

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9BQI6-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MEDGTPKHII QMTGFKMEEK EALVKLLLKL DCTFIKSEKY KNCTHLIAER
60 70 80 90 100
LCKSEKFLAA CAAGKWILTK DYIIHSAKSG RWLDETTYEW GYKIEKDSRY
110 120 130 140 150
SPQMQSAPKR WREELKRTGA PGAFHRWKVV LLVRTDKRSD SLIRVLEAGK
160 170 180 190 200
ANVILPKSSP SGITHVIASN ARIKAEKEKD NFKAPFYPIQ YLGDFLLEKE
210 220 230 240 250
IQNDEDSQTN SVWTEHSNEE TNKDFRKDAG FLEMKGALRE TMYRTQKEMQ
260 270 280 290 300
NHEDVNVGSI LIQHHKKEKF SGSSKDLKFV KMRNTFGSHT YENQKEIKKK
310 320 330 340 350
DEDIQRSYTL RRKRKKGKES NCKKGVEHEK IKSTLRRHIY NRDQKEMKNS
360 370 380 390 400
IFAEYAKESK AMAIKTDVDV VEIKNTLRKH IYRAQAVRYN CIRIDKQPVY
410 420 430 440 450
NVEVKNAEFP RGVLNLIESL IEGHFFKEAI EELSTLQAHY IPPVCVLHAL
460 470 480 490 500
LENVLQDNID TFSGRYFHIL SALLHLHPPW KSPAMSRYYL ELFQCPTCMK
510 520 530 540 550
GAWSLVEVLI RSCLFNESFC HQISENIGSK VLHLTLLKFF FNLIESEVQH
560 570 580 590 600
LSQKLYDWSD SQNLKITGKA MLLEIFWSGS ETSGLLTKPV NMLLEWTIYS
610 620 630 640 650
HKEKFKSNDV FKHELAYLLA GILGAAIDYW IFLGLKMGRN VMRHMSDDLG
660 670 680 690 700
SYVSLSCDDF SSQELEIFIC SFSSSWLQMF VAEAVFKKLC LQSSGSVSSE
710 720 730 740 750
PLSLQKMVYS YLPALGKTGV LGSGKIQVSK KIGQRPCFDS QRTLLMLNGT
760 770 780 790 800
KQKQVEGLPE LLDLNLAKCS SSLKKLKKKS EGELSCSKEN CPSVVKKMNF
810 820 830 840 850
HKTNLKGETA LHRACINNQV EKLILLLSLP GIDINVKDNA GWTPLHEACN
860 870 880 890 900
YGNTVCVQEI LQRCPEVDLL TQVDGVTPLH DALSNGHVEI GKLLLQHGGP
910 920 930 940 950
VLLQQRNAKG ELPLDYVVSP QIKEELFAIT KIEDTVENFH AQAEKHFHYQ
960 970 980 990 1000
QLEFGSFLLS RMLLNFCSIF DLSSEFILAS KGLTHLNELL MACKSHKETT
1010 1020 1030 1040 1050
SVHTDWLLDL YAGNIKTLQK LPHILKELPE NLKVCPGVHT EALMITLEMM

CRSVMEFS
Length:1,058
Mass (Da):121,050
Last modified:July 1, 2008 - v2
Checksum:iC624008C7CC25FE6
GO
Isoform 2 (identifier: Q9BQI6-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     145-179: VLEAGKANVILPKSSPSGITHVIASNARIKAEKEK → KKFRMMKIPKPILFGLNIAMKKQTKISGKMQDFLK
     180-1058: Missing.

Note: No experimental confirmation available.
Show »
Length:179
Mass (Da):21,003
Checksum:i04B900457E943E18
GO

Sequence cautioni

The sequence AAH54885 differs from that shown. Contaminating sequence. Potential poly-A sequence.Curated
The sequence AAH54885 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated
The sequence AAH70332 differs from that shown. Contaminating sequence. Potential poly-A sequence.Curated
The sequence AAH70332 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated
The sequence AAI07572 differs from that shown. Reason: Erroneous initiation.Curated
The sequence CAB66495 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti24V → A in CAB43397 (PubMed:17974005).Curated1
Sequence conflicti103Q → R in CAB43397 (PubMed:17974005).Curated1
Sequence conflicti182F → S in AAH54885 (PubMed:15489334).Curated1
Sequence conflicti221T → A in CAB43397 (PubMed:17974005).Curated1
Sequence conflicti328H → Q in AAH70332 (PubMed:15489334).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_059120288S → R. Corresponds to variant dbSNP:rs6891545Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_056914145 – 179VLEAG…AEKEK → KKFRMMKIPKPILFGLNIAM KKQTKISGKMQDFLK in isoform 2. 1 PublicationAdd BLAST35
Alternative sequenceiVSP_056915180 – 1058Missing in isoform 2. 1 PublicationAdd BLAST879

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK297452 mRNA Translation: BAG59876.1
AC008534 Genomic DNA No translation available.
AC025766 Genomic DNA No translation available.
BC054885 mRNA Translation: AAH54885.2 Sequence problems.
BC070332 mRNA Translation: AAH70332.1 Sequence problems.
BC107571 mRNA Translation: AAI07572.1 Different initiation.
AL050298 mRNA Translation: CAB43397.2
AL136560 mRNA Translation: CAB66495.1 Different initiation.
CR533539 mRNA Translation: CAG38570.1
CCDSiCCDS4071.2 [Q9BQI6-1]
PIRiT08704
RefSeqiNP_115666.2, NM_032290.3 [Q9BQI6-1]
XP_016865468.1, XM_017009979.1 [Q9BQI6-1]
UniGeneiHs.657315

Genome annotation databases

EnsembliENST00000265140; ENSP00000265140; ENSG00000133302 [Q9BQI6-1]
ENST00000508130; ENSP00000424232; ENSG00000133302 [Q9BQI6-2]
GeneIDi84250
KEGGihsa:84250
UCSCiuc003kkr.5 human [Q9BQI6-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiSLF1_HUMAN
AccessioniPrimary (citable) accession number: Q9BQI6
Secondary accession number(s): B4DMG4
, Q3B7K4, Q6NSA5, Q6PHW9, Q9Y402
Entry historyiIntegrated into UniProtKB/Swiss-Prot: June 27, 2006
Last sequence update: July 1, 2008
Last modified: June 20, 2018
This is version 132 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 5
    Human chromosome 5: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health