Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Evolutionarily conserved signaling intermediate in Toll pathway, mitochondrial

Gene

ECSIT

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Adapter protein of the Toll-like and IL-1 receptor signaling pathway that is involved in the activation of NF-kappa-B via MAP3K1. Promotes proteolytic activation of MAP3K1. Involved in the BMP signaling pathway. Required for normal embryonic development (By similarity).By similarity
Required for efficient assembly of mitochondrial NADH:ubiquinone oxidoreductase.

GO - Molecular functioni

  • oxidoreductase activity, acting on NAD(P)H Source: UniProtKB

GO - Biological processi

Keywordsi

Biological processImmunity, Innate immunity

Enzyme and pathway databases

ReactomeiR-HSA-166058 MyD88:Mal cascade initiated on plasma membrane
R-HSA-6799198 Complex I biogenesis
R-HSA-975138 TRAF6 mediated induction of NFkB and MAP kinases upon TLR7/8 or 9 activation
R-HSA-975871 MyD88 cascade initiated on plasma membrane

Names & Taxonomyi

Protein namesi
Recommended name:
Evolutionarily conserved signaling intermediate in Toll pathway, mitochondrial
Alternative name(s):
Protein SITPEC
Gene namesi
Name:ECSIT
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 19

Organism-specific databases

EuPathDBiHostDB:ENSG00000130159.13
HGNCiHGNC:29548 ECSIT
MIMi608388 gene
neXtProtiNX_Q9BQ95

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Mitochondrion, Nucleus

Pathology & Biotechi

Organism-specific databases

DisGeNETi51295
OpenTargetsiENSG00000130159
PharmGKBiPA147358104

Polymorphism and mutation databases

BioMutaiECSIT
DMDMi74752234

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Transit peptidei1 – 48MitochondrionSequence analysisAdd BLAST48
ChainiPRO_000029198549 – 431Evolutionarily conserved signaling intermediate in Toll pathway, mitochondrialAdd BLAST383

Proteomic databases

EPDiQ9BQ95
MaxQBiQ9BQ95
PaxDbiQ9BQ95
PeptideAtlasiQ9BQ95
PRIDEiQ9BQ95
ProteomicsDBi78645
78646 [Q9BQ95-2]
TopDownProteomicsiQ9BQ95-1 [Q9BQ95-1]

PTM databases

iPTMnetiQ9BQ95
PhosphoSitePlusiQ9BQ95
SwissPalmiQ9BQ95

Expressioni

Gene expression databases

BgeeiENSG00000130159
CleanExiHS_ECSIT
ExpressionAtlasiQ9BQ95 baseline and differential
GenevisibleiQ9BQ95 HS

Organism-specific databases

HPAiHPA042979

Interactioni

Subunit structurei

Interacts with MAP3K1, SMAD4 and TRAF6. Interacts with SMAD1 only after BMP4-treatment (By similarity). Part of the mitochondrial complex I assembly (MCIA) complex. The complex comprises at least TMEM126B, NDUFAF1, ECSIT, and ACAD9 (By similarity). Interacts with NDUFAF1 (PubMed:17344420). Interacts with ACAD9 (PubMed:20816094). Interacts with TRIM59 (By similarity).By similarity

Binary interactionsi

Show more details

Protein-protein interaction databases

BioGridi119446, 118 interactors
CORUMiQ9BQ95
IntActiQ9BQ95, 73 interactors
MINTiQ9BQ95
STRINGi9606.ENSP00000270517

Structurei

3D structure databases

ProteinModelPortaliQ9BQ95
SMRiQ9BQ95
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the ECSIT family.Curated

Keywords - Domaini

Transit peptide

Phylogenomic databases

eggNOGiKOG3941 Eukaryota
ENOG41100I6 LUCA
GeneTreeiENSGT00390000005147
HOGENOMiHOG000112324
HOVERGENiHBG059532
InParanoidiQ9BQ95
KOiK04405
OMAiINVMPKG
OrthoDBiEOG091G07N5
PhylomeDBiQ9BQ95
TreeFamiTF314943

Family and domain databases

InterProiView protein in InterPro
IPR029342 ECIST_C
IPR010418 ECSIT
PANTHERiPTHR13113 PTHR13113, 1 hit
PfamiView protein in Pfam
PF06239 ECSIT, 1 hit
PF14784 ECSIT_C, 1 hit
SMARTiView protein in SMART
SM01284 ECSIT_Cterm, 1 hit

Sequences (4)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9BQ95-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSWVQATLLA RGLCRAWGGT CGAALTGTSI SQVPRRLPRG LHCSAAAHSS
60 70 80 90 100
EQSLVPSPPE PRQRPTKALV PFEDLFGQAP GGERDKASFL QTVQKFAEHS
110 120 130 140 150
VRKRGHIDFI YLALRKMREY GVERDLAVYN QLLNIFPKEV FRPRNIIQRI
160 170 180 190 200
FVHYPRQQEC GIAVLEQMEN HGVMPNKETE FLLIQIFGRK SYPMLKLVRL
210 220 230 240 250
KLWFPRFMNV NPFPVPRDLP QDPVELAMFG LRHMEPDLSA RVTIYQVPLP
260 270 280 290 300
KDSTGAADPP QPHIVGIQSP DQQAALARHN PARPVFVEGP FSLWLRNKCV
310 320 330 340 350
YYHILRADLL PPEEREVEET PEEWNLYYPM QLDLEYVRSG WDNYEFDINE
360 370 380 390 400
VEEGPVFAMC MAGAHDQATM AKWIQGLQET NPTLAQIPVV FRLAGSTREL
410 420 430
QTSSAGLEEP PLPEDHQEED DNLQRQQQGQ S
Length:431
Mass (Da):49,148
Last modified:June 1, 2001 - v1
Checksum:i42AFEBFFA6953C80
GO
Isoform 2 (identifier: Q9BQ95-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     267-296: IQSPDQQAALARHNPARPVFVEGPFSLWLR → SGRDAGGVEPLLPDAAGPGVCEEWLGQLRV
     297-431: Missing.

Show »
Length:296
Mass (Da):33,214
Checksum:i69EDA93B95F970E8
GO
Isoform 3 (identifier: Q9BQ95-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     35-248: Missing.

Note: Gene prediction based on EST data.
Show »
Length:217
Mass (Da):24,211
Checksum:i6AB416587472AFD0
GO
Isoform 4 (identifier: Q9BQ95-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     266-296: GIQSPDQQAALARHNPARPVFVEGPFSLWLR → ELTCCPRRRGKWKRRRRSGTSTTRCSWTWSM
     297-431: Missing.

Note: No experimental confirmation available.
Show »
Length:296
Mass (Da):33,938
Checksum:i342042BA474DDFE6
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti242V → A in AK314905 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_032907278R → C1 PublicationCorresponds to variant dbSNP:rs34803265Ensembl.1
Natural variantiVAR_032908406G → R. Corresponds to variant dbSNP:rs2302971Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_04668935 – 248Missing in isoform 3. CuratedAdd BLAST214
Alternative sequenceiVSP_055626266 – 296GIQSP…SLWLR → ELTCCPRRRGKWKRRRRSGT STTRCSWTWSM in isoform 4. 1 PublicationAdd BLAST31
Alternative sequenceiVSP_026345267 – 296IQSPD…SLWLR → SGRDAGGVEPLLPDAAGPGV CEEWLGQLRV in isoform 2. 1 PublicationAdd BLAST30
Alternative sequenceiVSP_026346297 – 431Missing in isoform 2 and isoform 4. 2 PublicationsAdd BLAST135

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF243044 mRNA Translation: AAF62100.1
AK314905 mRNA No translation available.
CR457204 mRNA Translation: CAG33485.1
AC008481 Genomic DNA No translation available.
BC000193 mRNA Translation: AAH00193.1
BC005119 mRNA Translation: AAH05119.1
BC008279 mRNA Translation: AAH08279.1
CCDSiCCDS12262.1 [Q9BQ95-1]
CCDS45979.1 [Q9BQ95-3]
CCDS45980.1 [Q9BQ95-2]
CCDS59353.1 [Q9BQ95-4]
RefSeqiNP_001135936.1, NM_001142464.2 [Q9BQ95-2]
NP_001135937.1, NM_001142465.2 [Q9BQ95-3]
NP_001230133.1, NM_001243204.1 [Q9BQ95-4]
NP_057665.2, NM_016581.4 [Q9BQ95-1]
UniGeneiHs.515146

Genome annotation databases

EnsembliENST00000252440; ENSP00000252440; ENSG00000130159 [Q9BQ95-2]
ENST00000270517; ENSP00000270517; ENSG00000130159 [Q9BQ95-1]
ENST00000417981; ENSP00000412712; ENSG00000130159 [Q9BQ95-3]
ENST00000591104; ENSP00000466559; ENSG00000130159 [Q9BQ95-4]
GeneIDi51295
KEGGihsa:51295
UCSCiuc002msb.4 human [Q9BQ95-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiECSIT_HUMAN
AccessioniPrimary (citable) accession number: Q9BQ95
Secondary accession number(s): E9PAN9
, K7EMM0, Q96HQ7, Q9NYI1
Entry historyiIntegrated into UniProtKB/Swiss-Prot: June 26, 2007
Last sequence update: June 1, 2001
Last modified: July 18, 2018
This is version 128 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 19
    Human chromosome 19: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health