Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Testican-3

Gene

SPOCK3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

May participate in diverse steps of neurogenesis. Inhibits the processing of pro-matrix metalloproteinase 2 (MMP-2) by MT1-MMP and MT3-MMP. May interfere with tumor invasion.

GO - Molecular functioni

GO - Biological processi

  • negative regulation of cell motility Source: ParkinsonsUK-UCL
  • negative regulation of endopeptidase activity Source: UniProtKB
  • peptide cross-linking via chondroitin 4-sulfate glycosaminoglycan Source: Ensembl

Keywordsi

Molecular functionMetalloenzyme inhibitor, Metalloprotease inhibitor, Protease inhibitor
LigandCalcium

Enzyme and pathway databases

ReactomeiR-HSA-1592389 Activation of Matrix Metalloproteinases

Protein family/group databases

MEROPSiI31.007

Names & Taxonomyi

Protein namesi
Recommended name:
Testican-3
Alternative name(s):
SPARC/osteonectin, CWCV, and Kazal-like domains proteoglycan 3
Gene namesi
Name:SPOCK3
Synonyms:TICN3
ORF Names:UNQ409/PRO771
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 4

Organism-specific databases

EuPathDBiHostDB:ENSG00000196104.10
HGNCiHGNC:13565 SPOCK3
MIMi607989 gene
neXtProtiNX_Q9BQ16

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Extracellular matrix, Secreted

Pathology & Biotechi

Organism-specific databases

DisGeNETi50859
OpenTargetsiENSG00000196104
PharmGKBiPA134977377

Polymorphism and mutation databases

BioMutaiSPOCK3
DMDMi67473703

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 21Sequence analysisAdd BLAST21
ChainiPRO_000002670322 – 436Testican-3Add BLAST415

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Disulfide bondi90 ↔ 101By similarity
Disulfide bondi95 ↔ 111By similarity
Disulfide bondi139 ↔ 169By similarity
Disulfide bondi142 ↔ 162By similarity
Disulfide bondi151 ↔ 183By similarity
Disulfide bondi317 ↔ 341By similarity
Disulfide bondi352 ↔ 359By similarity
Disulfide bondi361 ↔ 380By similarity
Glycosylationi387O-linked (Xyl...) (glycosaminoglycan) serineSequence analysis1
Glycosylationi392O-linked (Xyl...) (glycosaminoglycan) serineSequence analysis1

Post-translational modificationi

Contains chondroitin sulfate and heparan sulfate O-linked oligosaccharides.By similarity

Keywords - PTMi

Disulfide bond, Glycoprotein, Heparan sulfate, Proteoglycan

Proteomic databases

PaxDbiQ9BQ16
PeptideAtlasiQ9BQ16
PRIDEiQ9BQ16
ProteomicsDBi78611
78612 [Q9BQ16-1]
78613 [Q9BQ16-2]
78614 [Q9BQ16-4]
TopDownProteomicsiQ9BQ16-2 [Q9BQ16-2]
Q9BQ16-3 [Q9BQ16-3]
Q9BQ16-5 [Q9BQ16-5]

PTM databases

iPTMnetiQ9BQ16
PhosphoSitePlusiQ9BQ16

Expressioni

Tissue specificityi

Expressed in brain.

Gene expression databases

BgeeiENSG00000196104
CleanExiHS_SPOCK3
ExpressionAtlasiQ9BQ16 baseline and differential
GenevisibleiQ9BQ16 HS

Organism-specific databases

HPAiHPA075020

Interactioni

Protein-protein interaction databases

BioGridi119160, 4 interactors
IntActiQ9BQ16, 2 interactors
MINTiQ9BQ16
STRINGi9606.ENSP00000349677

Structurei

3D structure databases

ProteinModelPortaliQ9BQ16
SMRiQ9BQ16
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini133 – 185Kazal-likePROSITE-ProRule annotationAdd BLAST53
Domaini314 – 380Thyroglobulin type-1PROSITE-ProRule annotationAdd BLAST67

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi394 – 436Asp-richAdd BLAST43

Keywords - Domaini

Signal

Phylogenomic databases

eggNOGiKOG3555 Eukaryota
ENOG410Y6A8 LUCA
GeneTreeiENSGT00510000046429
HOGENOMiHOG000293295
HOVERGENiHBG026595
InParanoidiQ9BQ16
KOiK08136
OMAiRLTHSMK
OrthoDBiEOG091G086I
PhylomeDBiQ9BQ16
TreeFamiTF317779

Family and domain databases

CDDicd00191 TY, 1 hit
Gene3Di4.10.800.10, 1 hit
InterProiView protein in InterPro
IPR011992 EF-hand-dom_pair
IPR002350 Kazal_dom
IPR036058 Kazal_dom_sf
IPR019577 SPARC/Testican_Ca-bd-dom
IPR000716 Thyroglobulin_1
IPR036857 Thyroglobulin_1_sf
PfamiView protein in Pfam
PF07648 Kazal_2, 1 hit
PF10591 SPARC_Ca_bdg, 1 hit
PF00086 Thyroglobulin_1, 1 hit
SMARTiView protein in SMART
SM00280 KAZAL, 1 hit
SM00211 TY, 1 hit
SUPFAMiSSF100895 SSF100895, 1 hit
SSF47473 SSF47473, 1 hit
SSF57610 SSF57610, 1 hit
PROSITEiView protein in PROSITE
PS51465 KAZAL_2, 1 hit
PS00484 THYROGLOBULIN_1_1, 1 hit
PS51162 THYROGLOBULIN_1_2, 1 hit

Sequences (9)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 9 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 3 (identifier: Q9BQ16-3) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MLKVSAVLCV CAAAWCSQSL AAAAAVAAAG GRSDGGNFLD DKQWLTTISQ
60 70 80 90 100
YDKEVGQWNK FRDEVEDDYF RTWSPGKPFD QALDPAKDPC LKMKCSRHKV
110 120 130 140 150
CIAQDSQTAV CISHRRLTHR MKEAGVDHRQ WRGPILSTCK QCPVVYPSPV
160 170 180 190 200
CGSDGHTYSF QCKLEYQACV LGKQISVKCE GHCPCPSDKP TSTSRNVKRA
210 220 230 240 250
CSDLEFREVA NRLRDWFKAL HESGSQNKKT KTLLRPERSR FDTSILPICK
260 270 280 290 300
DSLGWMFNRL DTNYDLLLDQ SELRSIYLDK NEQCTKAFFN SCDTYKDSLI
310 320 330 340 350
SNNEWCYCFQ RQQDPPCQTE LSNIQKRQGV KKLLGQYIPL CDEDGYYKPT
360 370 380 390 400
QCHGSVGQCW CVDRYGNEVM GSRINGVADC AIDFEISGDF ASGDFHEWTD
410 420 430
DEDDEDDIMN DEDEIEDDDE DEGDDDDGGD DHDVYI
Length:436
Mass (Da):49,429
Last modified:May 10, 2005 - v2
Checksum:iAAEDD1998C656FC0
GO
Isoform 1 (identifier: Q9BQ16-1) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     64-66: Missing.

Show »
Length:433
Mass (Da):49,072
Checksum:iB697CDE58F7028AF
GO
Isoform 2 (identifier: Q9BQ16-2) [UniParc]FASTAAdd to basket
Also known as: N-tes

The sequence of this isoform differs from the canonical sequence as follows:
     314-316: DPP → GKR
     317-436: Missing.

Show »
Length:316
Mass (Da):35,950
Checksum:i6607E14FC72D4F44
GO
Isoform 4 (identifier: Q9BQ16-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-66: MLKVSAVLCV...QWNKFRDEVE → MITQDHIHMSSGLSQ

Note: No experimental confirmation available.
Show »
Length:385
Mass (Da):44,061
Checksum:i00E0842D266E4A83
GO
Isoform 5 (identifier: Q9BQ16-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     64-161: Missing.

Show »
Length:338
Mass (Da):38,282
Checksum:i2259AE11269F6627
GO
Isoform 6 (identifier: Q9BQ16-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-24: MLKVSAVLCVCAAAWCSQSLAAAA → MINNGSPQSLSMTRKSDSGTNSET
     25-120: Missing.

Note: No experimental confirmation available.
Show »
Length:340
Mass (Da):38,678
Checksum:i46149953687E2F86
GO
Isoform 7 (identifier: Q9BQ16-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-120: Missing.

Show »
Length:316
Mass (Da):36,153
Checksum:i8E585B9CAF41679D
GO
Isoform 8 (identifier: Q9BQ16-8) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     64-66: Missing.
     200-240: ACSDLEFREVANRLRDWFKALHESGSQNKKTKTLLRPERSR → G

Note: No experimental confirmation available.
Show »
Length:393
Mass (Da):44,272
Checksum:i6BAF82C67C0F0A0C
GO
Isoform 9 (identifier: Q9BQ16-9) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     64-66: Missing.
     314-316: DPP → GKR
     317-436: Missing.

Note: No experimental confirmation available.
Show »
Length:313
Mass (Da):35,592
Checksum:i2C98BC69CACE0802
GO

Sequence cautioni

The sequence BAG58995 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti348K → M in CAA04775 (Ref. 1) Curated1
Sequence conflicti405E → G in BAG58265 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_051562112I → V. Corresponds to variant dbSNP:rs9685645Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0466861 – 120Missing in isoform 7. 1 PublicationAdd BLAST120
Alternative sequenceiVSP_0436811 – 66MLKVS…RDEVE → MITQDHIHMSSGLSQ in isoform 4. 1 PublicationAdd BLAST66
Alternative sequenceiVSP_0458991 – 24MLKVS…LAAAA → MINNGSPQSLSMTRKSDSGT NSET in isoform 6. 1 PublicationAdd BLAST24
Alternative sequenceiVSP_04590025 – 120Missing in isoform 6. 1 PublicationAdd BLAST96
Alternative sequenceiVSP_04510464 – 161Missing in isoform 5. 1 PublicationAdd BLAST98
Alternative sequenceiVSP_01359864 – 66Missing in isoform 1, isoform 8 and isoform 9. 2 Publications3
Alternative sequenceiVSP_046687200 – 240ACSDL…PERSR → G in isoform 8. 1 PublicationAdd BLAST41
Alternative sequenceiVSP_005334314 – 316DPP → GKR in isoform 2 and isoform 9. 1 Publication3
Alternative sequenceiVSP_005335317 – 436Missing in isoform 2 and isoform 9. 1 PublicationAdd BLAST120

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ001454 mRNA Translation: CAA04775.1
AB056866 mRNA Translation: BAB64908.1
AY358973 mRNA Translation: AAQ89332.1
AK091078 mRNA Translation: BAG52279.1
AK295281 mRNA Translation: BAG58265.1
AK295407 mRNA Translation: BAG58358.1
AK294637 mRNA Translation: BAG57816.1
AK295015 mRNA Translation: BAG58075.1
AK296291 mRNA Translation: BAG58995.1 Different initiation.
AK313042 mRNA Translation: BAG35874.1
AC010103 Genomic DNA No translation available.
AC020599 Genomic DNA No translation available.
AC023492 Genomic DNA No translation available.
AC107210 Genomic DNA No translation available.
CH471056 Genomic DNA Translation: EAX04811.1
BC000460 mRNA Translation: AAH00460.1
BC003017 mRNA Translation: AAH03017.1
BC013983 mRNA Translation: AAH13983.1
CCDSiCCDS34095.1 [Q9BQ16-1]
CCDS54817.1 [Q9BQ16-3]
CCDS56343.1 [Q9BQ16-7]
CCDS56344.1 [Q9BQ16-4]
CCDS56346.1 [Q9BQ16-8]
CCDS56347.1 [Q9BQ16-9]
CCDS58931.1 [Q9BQ16-5]
RefSeqiNP_001035249.1, NM_001040159.1 [Q9BQ16-1]
NP_001191281.1, NM_001204352.1 [Q9BQ16-4]
NP_001191282.1, NM_001204353.1 [Q9BQ16-7]
NP_001191283.1, NM_001204354.1
NP_001191284.1, NM_001204355.1 [Q9BQ16-6]
NP_001191285.1, NM_001204356.1 [Q9BQ16-8]
NP_001191287.1, NM_001204358.1 [Q9BQ16-9]
NP_001238896.1, NM_001251967.1 [Q9BQ16-5]
NP_058646.2, NM_016950.2 [Q9BQ16-3]
XP_011530320.1, XM_011532018.1 [Q9BQ16-3]
XP_016863747.1, XM_017008258.1 [Q9BQ16-1]
UniGeneiHs.481133

Genome annotation databases

EnsembliENST00000357154; ENSP00000349677; ENSG00000196104 [Q9BQ16-3]
ENST00000357545; ENSP00000350153; ENSG00000196104 [Q9BQ16-1]
ENST00000421836; ENSP00000411344; ENSG00000196104 [Q9BQ16-4]
ENST00000502330; ENSP00000423606; ENSG00000196104 [Q9BQ16-3]
ENST00000504953; ENSP00000425570; ENSG00000196104 [Q9BQ16-1]
ENST00000506886; ENSP00000420920; ENSG00000196104 [Q9BQ16-3]
ENST00000510741; ENSP00000426716; ENSG00000196104 [Q9BQ16-8]
ENST00000511269; ENSP00000425502; ENSG00000196104 [Q9BQ16-1]
ENST00000511531; ENSP00000423421; ENSG00000196104 [Q9BQ16-3]
ENST00000512648; ENSP00000426177; ENSG00000196104 [Q9BQ16-9]
ENST00000512681; ENSP00000426318; ENSG00000196104 [Q9BQ16-5]
ENST00000541354; ENSP00000444789; ENSG00000196104 [Q9BQ16-7]
GeneIDi50859
KEGGihsa:50859
UCSCiuc003iri.2 human [Q9BQ16-3]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiTICN3_HUMAN
AccessioniPrimary (citable) accession number: Q9BQ16
Secondary accession number(s): B2R7M7
, B3KR67, B4DGK5, B4DHB4, B4DHV3, B4DI46, B4DJY3, E7EP61, F5H099, O75705, Q6UW53, Q96Q26
Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 19, 2002
Last sequence update: May 10, 2005
Last modified: July 18, 2018
This is version 160 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 4
    Human chromosome 4: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health