Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Homeodomain-only protein

Gene

HOPX

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Atypical homeodomain protein which does not bind DNA and is required to modulate cardiac growth and development. Acts via its interaction with SRF, thereby modulating the expression of SRF-dependent cardiac-specific genes and cardiac development. Prevents SRF-dependent transcription either by inhibiting SRF binding to DNA or by recruiting histone deacetylase (HDAC) proteins that prevent transcription by SRF. Overexpression causes cardiac hypertrophy (By similarity). May act as a tumor suppressor. Acts as a co-chaperone for HSPA1A and HSPA1B chaperone proteins and assists in chaperone-mediated protein refolding (PubMed:27708256).By similarity1 Publication

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
DNA bindingi3 – 62Homeobox; atypicalPROSITE-ProRule annotationAdd BLAST60

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionDevelopmental protein, Repressor
Biological processTranscription, Transcription regulation

Enzyme and pathway databases

SIGNORiQ9BPY8

Names & Taxonomyi

Protein namesi
Recommended name:
Homeodomain-only protein
Alternative name(s):
Lung cancer-associated Y protein
Not expressed in choriocarcinoma protein 1
Odd homeobox protein 1
Gene namesi
Name:HOPX
Synonyms:HOD, HOP, LAGY, NECC1, OB1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 4

Organism-specific databases

EuPathDBiHostDB:ENSG00000171476.21
HGNCiHGNC:24961 HOPX
MIMi607275 gene
neXtProtiNX_Q9BPY8

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Nucleus

Pathology & Biotechi

Keywords - Diseasei

Proto-oncogene

Organism-specific databases

DisGeNETi84525
OpenTargetsiENSG00000171476
PharmGKBiPA162391564

Polymorphism and mutation databases

BioMutaiHOPX
DMDMi60392394

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000491291 – 73Homeodomain-only proteinAdd BLAST73

Proteomic databases

PaxDbiQ9BPY8
PeptideAtlasiQ9BPY8
PRIDEiQ9BPY8
ProteomicsDBi78595
78596 [Q9BPY8-2]

PTM databases

iPTMnetiQ9BPY8
PhosphoSitePlusiQ9BPY8

Expressioni

Tissue specificityi

Widely expressed. Expressed in the heart, brain, placenta, lung, skeletal and smooth muscles, uterus, urinary bladder, kidney and spleen. Down-regulated in some types of cancer such as lung cancer, choriocarcinoma, head and neck squamous cell carcinoma and oral squamous cell carcinoma.2 Publications

Gene expression databases

BgeeiENSG00000171476 Expressed in 225 organ(s), highest expression level in caput epididymis
CleanExiHS_HOPX
GenevisibleiQ9BPY8 HS

Organism-specific databases

HPAiCAB018632
HPA030180

Interactioni

Subunit structurei

Interacts with serum response factor (SRF). Component of a large complex containing histone deacetylases such as HDAC2 (By similarity). Interacts with the acetylated forms of HSPA1A and HSPA1B. Interacts with HSPA8 (PubMed:27708256).By similarity1 Publication

Binary interactionsi

WithEntry#Exp.IntActNotes
TCF12Q990813EBI-10295883,EBI-722877

Protein-protein interaction databases

BioGridi124117, 11 interactors
IntActiQ9BPY8, 2 interactors
STRINGi9606.ENSP00000450527

Structurei

3D structure databases

ProteinModelPortaliQ9BPY8
SMRiQ9BPY8
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Keywords - Domaini

Homeobox

Phylogenomic databases

eggNOGiKOG0490 Eukaryota
ENOG410YIJ3 LUCA
GeneTreeiENSGT00390000017143
HOGENOMiHOG000112932
HOVERGENiHBG051921
InParanoidiQ9BPY8
OMAiKVSKHPD
OrthoDBiEOG091G1BXE
PhylomeDBiQ9BPY8

Family and domain databases

CDDicd00086 homeodomain, 1 hit
InterProiView protein in InterPro
IPR009057 Homeobox-like_sf
IPR001356 Homeobox_dom
IPR039162 HOPX
PANTHERiPTHR21408 PTHR21408, 1 hit
PfamiView protein in Pfam
PF00046 Homeobox, 1 hit
SMARTiView protein in SMART
SM00389 HOX, 1 hit
SUPFAMiSSF46689 SSF46689, 1 hit
PROSITEiView protein in PROSITE
PS50071 HOMEOBOX_2, 1 hit

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: Q9BPY8-1) [UniParc]FASTAAdd to basket
Also known as: A

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSAETASGPT EDQVEILEYN FNKVDKHPDS TTLCLIAAEA GLSEEETQKW
60 70
FKQRLAKWRR SEGLPSECRS VTD
Length:73
Mass (Da):8,260
Last modified:June 1, 2001 - v1
Checksum:iCE65E4D2A8972022
GO
Isoform 2 (identifier: Q9BPY8-2) [UniParc]FASTAAdd to basket
Also known as: B

The sequence of this isoform differs from the canonical sequence as follows:
     49-73: KWFKQRLAKWRRSEGLPSECRSVTD → GSDLISRSKIWHPESSPQREGYPHDSLPCLAFDYFSLLPPQCKEMV

Show »
Length:94
Mass (Da):10,459
Checksum:iF7E5ACD6B4802FCA
GO
Isoform 3 (identifier: Q9BPY8-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MLIFLGCYRRRLEERAGTM

Note: Gene prediction based on EST data.
Show »
Length:91
Mass (Da):10,427
Checksum:i681B58491A5732B8
GO
Isoform 4 (identifier: Q9BPY8-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MLIFLGCYRRRLEERAGTM
     49-73: KWFKQRLAKWRRSEGLPSECRSVTD → GSDLISRSKIWHPESSPQREGYPHDSLPCLAFDYFSLLPPQCKEMV

Note: Gene prediction based on EST data.
Show »
Length:112
Mass (Da):12,625
Checksum:i6CD4F04C488F915D
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti72T → I in AAH14225 (PubMed:15489334).Curated1
Isoform 2 (identifier: Q9BPY8-2)
Sequence conflicti76P → L in AAM46830 (PubMed:14516659).Curated1
Sequence conflicti76P → L in AAM46831 (PubMed:14516659).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0472901M → MLIFLGCYRRRLEERAGTM in isoform 3 and isoform 4. Curated1
Alternative sequenceiVSP_01265949 – 73KWFKQ…RSVTD → GSDLISRSKIWHPESSPQRE GYPHDSLPCLAFDYFSLLPP QCKEMV in isoform 2 and isoform 4. 1 PublicationAdd BLAST25

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF492675 mRNA Translation: AAM46827.1
AF492676 mRNA Translation: AAM46828.1
AF492677 mRNA Translation: AAM46829.1
AF492678 mRNA Translation: AAM46830.1
AF492679 mRNA Translation: AAM46831.1
AF492680 mRNA Translation: AAM46832.1
AF492681 mRNA Translation: AAM46833.1
AB059408 mRNA Translation: BAB40926.1
AB059409 mRNA Translation: BAB40927.1
AB059410 mRNA Translation: BAB40928.1
AF454763 mRNA Translation: AAL56613.1
AK289707 mRNA Translation: BAF82396.1
AC108215 Genomic DNA No translation available.
BC014225 mRNA Translation: AAH14225.1
CCDSiCCDS3507.1 [Q9BPY8-1]
CCDS47062.1 [Q9BPY8-3]
CCDS54767.1 [Q9BPY8-4]
RefSeqiNP_001138931.1, NM_001145459.1 [Q9BPY8-1]
NP_001138932.1, NM_001145460.1 [Q9BPY8-4]
NP_115884.4, NM_032495.5 [Q9BPY8-3]
NP_631957.1, NM_139211.4 [Q9BPY8-1]
NP_631958.1, NM_139212.3 [Q9BPY8-1]
XP_016864218.1, XM_017008729.1
XP_016864219.1, XM_017008730.1 [Q9BPY8-1]
XP_016864220.1, XM_017008731.1 [Q9BPY8-1]
XP_016864221.1, XM_017008732.1 [Q9BPY8-1]
XP_016864222.1, XM_017008733.1 [Q9BPY8-1]
XP_016864223.1, XM_017008734.1 [Q9BPY8-1]
UniGeneiHs.619396

Genome annotation databases

EnsembliENST00000317745; ENSP00000315198; ENSG00000171476 [Q9BPY8-1]
ENST00000337881; ENSP00000337330; ENSG00000171476 [Q9BPY8-1]
ENST00000381255; ENSP00000370654; ENSG00000171476 [Q9BPY8-1]
ENST00000381260; ENSP00000370659; ENSG00000171476 [Q9BPY8-2]
ENST00000420433; ENSP00000396275; ENSG00000171476 [Q9BPY8-3]
ENST00000503639; ENSP00000424101; ENSG00000171476 [Q9BPY8-1]
ENST00000508121; ENSP00000422175; ENSG00000171476 [Q9BPY8-1]
ENST00000553379; ENSP00000452340; ENSG00000171476 [Q9BPY8-1]
ENST00000554144; ENSP00000450527; ENSG00000171476 [Q9BPY8-4]
ENST00000555760; ENSP00000452098; ENSG00000171476 [Q9BPY8-1]
ENST00000556376; ENSP00000451794; ENSG00000171476 [Q9BPY8-1]
ENST00000556614; ENSP00000452003; ENSG00000171476 [Q9BPY8-1]
GeneIDi84525
KEGGihsa:84525
UCSCiuc003hbz.3 human [Q9BPY8-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF492675 mRNA Translation: AAM46827.1
AF492676 mRNA Translation: AAM46828.1
AF492677 mRNA Translation: AAM46829.1
AF492678 mRNA Translation: AAM46830.1
AF492679 mRNA Translation: AAM46831.1
AF492680 mRNA Translation: AAM46832.1
AF492681 mRNA Translation: AAM46833.1
AB059408 mRNA Translation: BAB40926.1
AB059409 mRNA Translation: BAB40927.1
AB059410 mRNA Translation: BAB40928.1
AF454763 mRNA Translation: AAL56613.1
AK289707 mRNA Translation: BAF82396.1
AC108215 Genomic DNA No translation available.
BC014225 mRNA Translation: AAH14225.1
CCDSiCCDS3507.1 [Q9BPY8-1]
CCDS47062.1 [Q9BPY8-3]
CCDS54767.1 [Q9BPY8-4]
RefSeqiNP_001138931.1, NM_001145459.1 [Q9BPY8-1]
NP_001138932.1, NM_001145460.1 [Q9BPY8-4]
NP_115884.4, NM_032495.5 [Q9BPY8-3]
NP_631957.1, NM_139211.4 [Q9BPY8-1]
NP_631958.1, NM_139212.3 [Q9BPY8-1]
XP_016864218.1, XM_017008729.1
XP_016864219.1, XM_017008730.1 [Q9BPY8-1]
XP_016864220.1, XM_017008731.1 [Q9BPY8-1]
XP_016864221.1, XM_017008732.1 [Q9BPY8-1]
XP_016864222.1, XM_017008733.1 [Q9BPY8-1]
XP_016864223.1, XM_017008734.1 [Q9BPY8-1]
UniGeneiHs.619396

3D structure databases

ProteinModelPortaliQ9BPY8
SMRiQ9BPY8
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi124117, 11 interactors
IntActiQ9BPY8, 2 interactors
STRINGi9606.ENSP00000450527

PTM databases

iPTMnetiQ9BPY8
PhosphoSitePlusiQ9BPY8

Polymorphism and mutation databases

BioMutaiHOPX
DMDMi60392394

Proteomic databases

PaxDbiQ9BPY8
PeptideAtlasiQ9BPY8
PRIDEiQ9BPY8
ProteomicsDBi78595
78596 [Q9BPY8-2]

Protocols and materials databases

DNASUi84525
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000317745; ENSP00000315198; ENSG00000171476 [Q9BPY8-1]
ENST00000337881; ENSP00000337330; ENSG00000171476 [Q9BPY8-1]
ENST00000381255; ENSP00000370654; ENSG00000171476 [Q9BPY8-1]
ENST00000381260; ENSP00000370659; ENSG00000171476 [Q9BPY8-2]
ENST00000420433; ENSP00000396275; ENSG00000171476 [Q9BPY8-3]
ENST00000503639; ENSP00000424101; ENSG00000171476 [Q9BPY8-1]
ENST00000508121; ENSP00000422175; ENSG00000171476 [Q9BPY8-1]
ENST00000553379; ENSP00000452340; ENSG00000171476 [Q9BPY8-1]
ENST00000554144; ENSP00000450527; ENSG00000171476 [Q9BPY8-4]
ENST00000555760; ENSP00000452098; ENSG00000171476 [Q9BPY8-1]
ENST00000556376; ENSP00000451794; ENSG00000171476 [Q9BPY8-1]
ENST00000556614; ENSP00000452003; ENSG00000171476 [Q9BPY8-1]
GeneIDi84525
KEGGihsa:84525
UCSCiuc003hbz.3 human [Q9BPY8-1]

Organism-specific databases

CTDi84525
DisGeNETi84525
EuPathDBiHostDB:ENSG00000171476.21
GeneCardsiHOPX
HGNCiHGNC:24961 HOPX
HPAiCAB018632
HPA030180
MIMi607275 gene
neXtProtiNX_Q9BPY8
OpenTargetsiENSG00000171476
PharmGKBiPA162391564
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG0490 Eukaryota
ENOG410YIJ3 LUCA
GeneTreeiENSGT00390000017143
HOGENOMiHOG000112932
HOVERGENiHBG051921
InParanoidiQ9BPY8
OMAiKVSKHPD
OrthoDBiEOG091G1BXE
PhylomeDBiQ9BPY8

Enzyme and pathway databases

SIGNORiQ9BPY8

Miscellaneous databases

ChiTaRSiHOPX human
GeneWikiiHOPX
GenomeRNAii84525
PROiPR:Q9BPY8
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000171476 Expressed in 225 organ(s), highest expression level in caput epididymis
CleanExiHS_HOPX
GenevisibleiQ9BPY8 HS

Family and domain databases

CDDicd00086 homeodomain, 1 hit
InterProiView protein in InterPro
IPR009057 Homeobox-like_sf
IPR001356 Homeobox_dom
IPR039162 HOPX
PANTHERiPTHR21408 PTHR21408, 1 hit
PfamiView protein in Pfam
PF00046 Homeobox, 1 hit
SMARTiView protein in SMART
SM00389 HOX, 1 hit
SUPFAMiSSF46689 SSF46689, 1 hit
PROSITEiView protein in PROSITE
PS50071 HOMEOBOX_2, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiHOP_HUMAN
AccessioniPrimary (citable) accession number: Q9BPY8
Secondary accession number(s): A8K0Z2
, E9PB55, G3V294, Q8N0V6, Q96CI1
Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 1, 2005
Last sequence update: June 1, 2001
Last modified: November 7, 2018
This is version 138 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 4
    Human chromosome 4: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again