Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 144 (18 Sep 2019)
Sequence version 1 (01 Jun 2001)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Homeodomain-only protein

Gene

HOPX

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Atypical homeodomain protein which does not bind DNA and is required to modulate cardiac growth and development. Acts via its interaction with SRF, thereby modulating the expression of SRF-dependent cardiac-specific genes and cardiac development. Prevents SRF-dependent transcription either by inhibiting SRF binding to DNA or by recruiting histone deacetylase (HDAC) proteins that prevent transcription by SRF. Overexpression causes cardiac hypertrophy (By similarity). May act as a tumor suppressor. Acts as a co-chaperone for HSPA1A and HSPA1B chaperone proteins and assists in chaperone-mediated protein refolding (PubMed:27708256).By similarity1 Publication

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section specifies the position and type of each DNA-binding domain present within the protein.<p><a href='/help/dna_bind' target='_top'>More...</a></p>DNA bindingi3 – 62Homeobox; atypicalPROSITE-ProRule annotationAdd BLAST60

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionDevelopmental protein, Repressor
Biological processTranscription, Transcription regulation

Enzyme and pathway databases

SIGNOR Signaling Network Open Resource

More...
SIGNORi
Q9BPY8

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Homeodomain-only protein
Alternative name(s):
Lung cancer-associated Y protein
Not expressed in choriocarcinoma protein 1
Odd homeobox protein 1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:HOPX
Synonyms:HOD, HOP, LAGY, NECC1, OB1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 4

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:24961 HOPX

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
607275 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q9BPY8

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Keywords - Diseasei

Proto-oncogene

Organism-specific databases

DisGeNET

More...
DisGeNETi
84525

Open Targets

More...
OpenTargetsi
ENSG00000171476

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA162391564

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q9BPY8

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
HOPX

Domain mapping of disease mutations (DMDM)

More...
DMDMi
60392394

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000491291 – 73Homeodomain-only proteinAdd BLAST73

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q9BPY8

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q9BPY8

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9BPY8

PeptideAtlas

More...
PeptideAtlasi
Q9BPY8

PRoteomics IDEntifications database

More...
PRIDEi
Q9BPY8

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
19147
32566
78595 [Q9BPY8-1]
78596 [Q9BPY8-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9BPY8

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9BPY8

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Widely expressed. Expressed in the heart, brain, placenta, lung, skeletal and smooth muscles, uterus, urinary bladder, kidney and spleen. Down-regulated in some types of cancer such as lung cancer, choriocarcinoma, head and neck squamous cell carcinoma and oral squamous cell carcinoma.2 Publications

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000171476 Expressed in 225 organ(s), highest expression level in caput epididymis

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9BPY8 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
CAB018632
HPA030180

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with serum response factor (SRF).

Component of a large complex containing histone deacetylases such as HDAC2 (By similarity).

Interacts with the acetylated forms of HSPA1A and HSPA1B.

Interacts with HSPA8 (PubMed:27708256).

By similarity1 Publication

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

WithEntry#Exp.IntActNotes
TCF12Q990813EBI-10295883,EBI-722877

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
124117, 12 interactors

Protein interaction database and analysis system

More...
IntActi
Q9BPY8, 4 interactors

Molecular INTeraction database

More...
MINTi
Q9BPY8

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000450527

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q9BPY8

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Keywords - Domaini

Homeobox

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG0490 Eukaryota
ENOG410YIJ3 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000017143

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000112932

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9BPY8

Identification of Orthologs from Complete Genome Data

More...
OMAi
KVSKHPD

Database of Orthologous Groups

More...
OrthoDBi
1567787at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9BPY8

Family and domain databases

Conserved Domains Database

More...
CDDi
cd00086 homeodomain, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR009057 Homeobox-like_sf
IPR001356 Homeobox_dom
IPR039162 HOPX

The PANTHER Classification System

More...
PANTHERi
PTHR21408 PTHR21408, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00046 Homeodomain, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00389 HOX, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF46689 SSF46689, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50071 HOMEOBOX_2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: Q9BPY8-1) [UniParc]FASTAAdd to basket
Also known as: A

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSAETASGPT EDQVEILEYN FNKVDKHPDS TTLCLIAAEA GLSEEETQKW
60 70
FKQRLAKWRR SEGLPSECRS VTD
Length:73
Mass (Da):8,260
Last modified:June 1, 2001 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iCE65E4D2A8972022
GO
Isoform 2 (identifier: Q9BPY8-2) [UniParc]FASTAAdd to basket
Also known as: B

The sequence of this isoform differs from the canonical sequence as follows:
     49-73: KWFKQRLAKWRRSEGLPSECRSVTD → GSDLISRSKIWHPESSPQREGYPHDSLPCLAFDYFSLLPPQCKEMV

Show »
Length:94
Mass (Da):10,459
Checksum:iF7E5ACD6B4802FCA
GO
Isoform 3 (identifier: Q9BPY8-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MLIFLGCYRRRLEERAGTM

Note: Gene prediction based on EST data.
Show »
Length:91
Mass (Da):10,427
Checksum:i681B58491A5732B8
GO
Isoform 4 (identifier: Q9BPY8-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MLIFLGCYRRRLEERAGTM
     49-73: KWFKQRLAKWRRSEGLPSECRSVTD → GSDLISRSKIWHPESSPQREGYPHDSLPCLAFDYFSLLPPQCKEMV

Note: Gene prediction based on EST data.
Show »
Length:112
Mass (Da):12,625
Checksum:i6CD4F04C488F915D
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti72T → I in AAH14225 (PubMed:15489334).Curated1
Isoform 2 (identifier: Q9BPY8-2)
Sequence conflicti76P → L in AAM46830 (PubMed:14516659).Curated1
Sequence conflicti76P → L in AAM46831 (PubMed:14516659).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0472901M → MLIFLGCYRRRLEERAGTM in isoform 3 and isoform 4. Curated1
Alternative sequenceiVSP_01265949 – 73KWFKQ…RSVTD → GSDLISRSKIWHPESSPQRE GYPHDSLPCLAFDYFSLLPP QCKEMV in isoform 2 and isoform 4. 1 PublicationAdd BLAST25

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF492675 mRNA Translation: AAM46827.1
AF492676 mRNA Translation: AAM46828.1
AF492677 mRNA Translation: AAM46829.1
AF492678 mRNA Translation: AAM46830.1
AF492679 mRNA Translation: AAM46831.1
AF492680 mRNA Translation: AAM46832.1
AF492681 mRNA Translation: AAM46833.1
AB059408 mRNA Translation: BAB40926.1
AB059409 mRNA Translation: BAB40927.1
AB059410 mRNA Translation: BAB40928.1
AF454763 mRNA Translation: AAL56613.1
AK289707 mRNA Translation: BAF82396.1
AC108215 Genomic DNA No translation available.
BC014225 mRNA Translation: AAH14225.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS3507.1 [Q9BPY8-1]
CCDS47062.1 [Q9BPY8-3]
CCDS54767.1 [Q9BPY8-4]

NCBI Reference Sequences

More...
RefSeqi
NP_001138931.1, NM_001145459.1 [Q9BPY8-1]
NP_001138932.1, NM_001145460.1 [Q9BPY8-4]
NP_115884.4, NM_032495.5 [Q9BPY8-3]
NP_631957.1, NM_139211.4 [Q9BPY8-1]
NP_631958.1, NM_139212.3 [Q9BPY8-1]
XP_016864218.1, XM_017008729.1
XP_016864219.1, XM_017008730.1 [Q9BPY8-1]
XP_016864220.1, XM_017008731.1 [Q9BPY8-1]
XP_016864221.1, XM_017008732.1 [Q9BPY8-1]
XP_016864222.1, XM_017008733.1 [Q9BPY8-1]
XP_016864223.1, XM_017008734.1 [Q9BPY8-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000317745; ENSP00000315198; ENSG00000171476 [Q9BPY8-1]
ENST00000337881; ENSP00000337330; ENSG00000171476 [Q9BPY8-1]
ENST00000381255; ENSP00000370654; ENSG00000171476 [Q9BPY8-1]
ENST00000381260; ENSP00000370659; ENSG00000171476 [Q9BPY8-2]
ENST00000420433; ENSP00000396275; ENSG00000171476 [Q9BPY8-3]
ENST00000503639; ENSP00000424101; ENSG00000171476 [Q9BPY8-1]
ENST00000508121; ENSP00000422175; ENSG00000171476 [Q9BPY8-1]
ENST00000553379; ENSP00000452340; ENSG00000171476 [Q9BPY8-1]
ENST00000554144; ENSP00000450527; ENSG00000171476 [Q9BPY8-4]
ENST00000555760; ENSP00000452098; ENSG00000171476 [Q9BPY8-1]
ENST00000556376; ENSP00000451794; ENSG00000171476 [Q9BPY8-1]
ENST00000556614; ENSP00000452003; ENSG00000171476 [Q9BPY8-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
84525

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:84525

UCSC genome browser

More...
UCSCi
uc003hbz.3 human [Q9BPY8-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF492675 mRNA Translation: AAM46827.1
AF492676 mRNA Translation: AAM46828.1
AF492677 mRNA Translation: AAM46829.1
AF492678 mRNA Translation: AAM46830.1
AF492679 mRNA Translation: AAM46831.1
AF492680 mRNA Translation: AAM46832.1
AF492681 mRNA Translation: AAM46833.1
AB059408 mRNA Translation: BAB40926.1
AB059409 mRNA Translation: BAB40927.1
AB059410 mRNA Translation: BAB40928.1
AF454763 mRNA Translation: AAL56613.1
AK289707 mRNA Translation: BAF82396.1
AC108215 Genomic DNA No translation available.
BC014225 mRNA Translation: AAH14225.1
CCDSiCCDS3507.1 [Q9BPY8-1]
CCDS47062.1 [Q9BPY8-3]
CCDS54767.1 [Q9BPY8-4]
RefSeqiNP_001138931.1, NM_001145459.1 [Q9BPY8-1]
NP_001138932.1, NM_001145460.1 [Q9BPY8-4]
NP_115884.4, NM_032495.5 [Q9BPY8-3]
NP_631957.1, NM_139211.4 [Q9BPY8-1]
NP_631958.1, NM_139212.3 [Q9BPY8-1]
XP_016864218.1, XM_017008729.1
XP_016864219.1, XM_017008730.1 [Q9BPY8-1]
XP_016864220.1, XM_017008731.1 [Q9BPY8-1]
XP_016864221.1, XM_017008732.1 [Q9BPY8-1]
XP_016864222.1, XM_017008733.1 [Q9BPY8-1]
XP_016864223.1, XM_017008734.1 [Q9BPY8-1]

3D structure databases

SMRiQ9BPY8
ModBaseiSearch...

Protein-protein interaction databases

BioGridi124117, 12 interactors
IntActiQ9BPY8, 4 interactors
MINTiQ9BPY8
STRINGi9606.ENSP00000450527

PTM databases

iPTMnetiQ9BPY8
PhosphoSitePlusiQ9BPY8

Polymorphism and mutation databases

BioMutaiHOPX
DMDMi60392394

Proteomic databases

jPOSTiQ9BPY8
MassIVEiQ9BPY8
PaxDbiQ9BPY8
PeptideAtlasiQ9BPY8
PRIDEiQ9BPY8
ProteomicsDBi19147
32566
78595 [Q9BPY8-1]
78596 [Q9BPY8-2]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
84525

Genome annotation databases

EnsembliENST00000317745; ENSP00000315198; ENSG00000171476 [Q9BPY8-1]
ENST00000337881; ENSP00000337330; ENSG00000171476 [Q9BPY8-1]
ENST00000381255; ENSP00000370654; ENSG00000171476 [Q9BPY8-1]
ENST00000381260; ENSP00000370659; ENSG00000171476 [Q9BPY8-2]
ENST00000420433; ENSP00000396275; ENSG00000171476 [Q9BPY8-3]
ENST00000503639; ENSP00000424101; ENSG00000171476 [Q9BPY8-1]
ENST00000508121; ENSP00000422175; ENSG00000171476 [Q9BPY8-1]
ENST00000553379; ENSP00000452340; ENSG00000171476 [Q9BPY8-1]
ENST00000554144; ENSP00000450527; ENSG00000171476 [Q9BPY8-4]
ENST00000555760; ENSP00000452098; ENSG00000171476 [Q9BPY8-1]
ENST00000556376; ENSP00000451794; ENSG00000171476 [Q9BPY8-1]
ENST00000556614; ENSP00000452003; ENSG00000171476 [Q9BPY8-1]
GeneIDi84525
KEGGihsa:84525
UCSCiuc003hbz.3 human [Q9BPY8-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
84525
DisGeNETi84525

GeneCards: human genes, protein and diseases

More...
GeneCardsi
HOPX
HGNCiHGNC:24961 HOPX
HPAiCAB018632
HPA030180
MIMi607275 gene
neXtProtiNX_Q9BPY8
OpenTargetsiENSG00000171476
PharmGKBiPA162391564

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG0490 Eukaryota
ENOG410YIJ3 LUCA
GeneTreeiENSGT00390000017143
HOGENOMiHOG000112932
InParanoidiQ9BPY8
OMAiKVSKHPD
OrthoDBi1567787at2759
PhylomeDBiQ9BPY8

Enzyme and pathway databases

SIGNORiQ9BPY8

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
HOPX human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
HOPX

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
84525
PharosiQ9BPY8

Protein Ontology

More...
PROi
PR:Q9BPY8

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000171476 Expressed in 225 organ(s), highest expression level in caput epididymis
GenevisibleiQ9BPY8 HS

Family and domain databases

CDDicd00086 homeodomain, 1 hit
InterProiView protein in InterPro
IPR009057 Homeobox-like_sf
IPR001356 Homeobox_dom
IPR039162 HOPX
PANTHERiPTHR21408 PTHR21408, 1 hit
PfamiView protein in Pfam
PF00046 Homeodomain, 1 hit
SMARTiView protein in SMART
SM00389 HOX, 1 hit
SUPFAMiSSF46689 SSF46689, 1 hit
PROSITEiView protein in PROSITE
PS50071 HOMEOBOX_2, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiHOP_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9BPY8
Secondary accession number(s): A8K0Z2
, E9PB55, G3V294, Q8N0V6, Q96CI1
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 1, 2005
Last sequence update: June 1, 2001
Last modified: September 18, 2019
This is version 144 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 4
    Human chromosome 4: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again