Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Dehydrogenase/reductase SDR family member 9

Gene

DHRS9

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

3-alpha-hydroxysteroid dehydrogenase that converts 3-alpha-tetrahydroprogesterone (allopregnanolone) to dihydroxyprogesterone and 3-alpha-androstanediol to dihydroxyprogesterone. May play a role in the biosynthesis of retinoic acid from retinaldehyde, but seems to have low activity with retinoids. Can utilize both NADH and NADPH.3 Publications

Kineticsi

  1. KM=9 µM for NADH1 Publication
  2. KM=72 µM for NAD1 Publication
  3. KM=5 µM for allopregnanolone1 Publication
  4. KM=7.5 µM for 3-alpha-androstanediol1 Publication
  5. KM=24 µM for androsterone1 Publication
  6. KM=12 µM for dihydrotestosterone1 Publication

    Sites

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    Binding sitei83NADBy similarity1
    Binding sitei164SubstrateBy similarity1
    Active sitei176Proton acceptorBy similarity1
    Binding sitei180NADBy similarity1

    Regions

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    Nucleotide bindingi34 – 58NADBy similarityAdd BLAST25

    GO - Molecular functioni

    • alcohol dehydrogenase (NAD) activity Source: UniProtKB
    • racemase and epimerase activity Source: UniProtKB
    • retinol dehydrogenase activity Source: UniProtKB
    • testosterone dehydrogenase (NAD+) activity Source: UniProtKB

    GO - Biological processi

    • 9-cis-retinoic acid biosynthetic process Source: UniProtKB
    • androgen metabolic process Source: UniProtKB
    • epithelial cell differentiation Source: UniProtKB
    • progesterone metabolic process Source: UniProtKB
    • retinol metabolic process Source: UniProtKB

    Keywordsi

    Molecular functionOxidoreductase
    LigandNAD, NADP

    Enzyme and pathway databases

    BioCyciMetaCyc:HS01113-MONOMER
    ReactomeiR-HSA-2453902 The canonical retinoid cycle in rods (twilight vision)
    R-HSA-5365859 RA biosynthesis pathway
    SABIO-RKiQ9BPW9

    Chemistry databases

    SwissLipidsiSLP:000000793

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Dehydrogenase/reductase SDR family member 9 (EC:1.1.-.-)
    Alternative name(s):
    3-alpha hydroxysteroid dehydrogenase
    Short name:
    3-alpha-HSD
    NADP-dependent retinol dehydrogenase/reductase
    RDH-E2
    RDHL
    Retinol dehydrogenase 15
    Short chain dehydrogenase/reductase family 9C member 4
    Short-chain dehydrogenase/reductase retSDR8
    Tracheobronchial epithelial cell-specific retinol dehydrogenase
    Short name:
    RDH-TBE
    Gene namesi
    Name:DHRS9
    Synonyms:RDH15, SDR9C4
    ORF Names:UNQ835/PRO1773
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    Proteomesi
    • UP000005640 Componenti: Chromosome 2

    Organism-specific databases

    EuPathDBiHostDB:ENSG00000073737.16
    HGNCiHGNC:16888 DHRS9
    MIMi612131 gene
    neXtProtiNX_Q9BPW9

    Subcellular locationi

    Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

    Keywords - Cellular componenti

    Endoplasmic reticulum, Membrane, Microsome

    Pathology & Biotechi

    Organism-specific databases

    DisGeNETi10170
    OpenTargetsiENSG00000073737
    PharmGKBiPA134913654

    Chemistry databases

    ChEMBLiCHEMBL5974

    Polymorphism and mutation databases

    BioMutaiDHRS9
    DMDMi74752227

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    Signal peptidei1 – 17Sequence analysisAdd BLAST17
    ChainiPRO_000004261718 – 319Dehydrogenase/reductase SDR family member 9Add BLAST302

    Proteomic databases

    EPDiQ9BPW9
    MaxQBiQ9BPW9
    PaxDbiQ9BPW9
    PeptideAtlasiQ9BPW9
    PRIDEiQ9BPW9
    ProteomicsDBi78582
    78583 [Q9BPW9-2]
    78584 [Q9BPW9-3]

    PTM databases

    PhosphoSitePlusiQ9BPW9

    Expressioni

    Tissue specificityi

    Highly expressed in trachea and epidermis. Detected at lower levels in spinal cord, bone marrow, brain, tongue, esophagus, heart, colon, testis, placenta, lung, skeletal muscle and lymph node.3 Publications

    Gene expression databases

    BgeeiENSG00000073737
    CleanExiHS_DHRS9
    ExpressionAtlasiQ9BPW9 baseline and differential
    GenevisibleiQ9BPW9 HS

    Organism-specific databases

    HPAiHPA036491
    HPA036667

    Interactioni

    Subunit structurei

    Homotetramer.By similarity

    Protein-protein interaction databases

    BioGridi115472, 10 interactors
    IntActiQ9BPW9, 1 interactor
    STRINGi9606.ENSP00000316670

    Chemistry databases

    BindingDBiQ9BPW9

    Structurei

    3D structure databases

    ProteinModelPortaliQ9BPW9
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Sequence similaritiesi

    Keywords - Domaini

    Signal

    Phylogenomic databases

    eggNOGiKOG1610 Eukaryota
    ENOG410Y7FK LUCA
    GeneTreeiENSGT00920000148940
    HOVERGENiHBG005482
    InParanoidiQ9BPW9
    KOiK11149
    OMAiLFPKTHY
    OrthoDBiEOG091G0LMI
    PhylomeDBiQ9BPW9
    TreeFamiTF325617

    Family and domain databases

    InterProiView protein in InterPro
    IPR036291 NAD(P)-bd_dom_sf
    IPR002347 SDR_fam
    PfamiView protein in Pfam
    PF00106 adh_short, 1 hit
    PRINTSiPR00081 GDHRDH
    PR00080 SDRFAMILY
    SUPFAMiSSF51735 SSF51735, 2 hits

    Sequences (4)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

    Isoform 1 (identifier: Q9BPW9-1) [UniParc]FASTAAdd to basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

            10         20         30         40         50
    MLFWVLGLLI LCGFLWTRKG KLKIEDITDK YIFITGCDSG FGNLAARTFD
    60 70 80 90 100
    KKGFHVIAAC LTESGSTALK AETSERLRTV LLDVTDPENV KRTAQWVKNQ
    110 120 130 140 150
    VGEKGLWGLI NNAGVPGVLA PTDWLTLEDY REPIEVNLFG LISVTLNMLP
    160 170 180 190 200
    LVKKAQGRVI NVSSVGGRLA IVGGGYTPSK YAVEGFNDSL RRDMKAFGVH
    210 220 230 240 250
    VSCIEPGLFK TNLADPVKVI EKKLAIWEQL SPDIKQQYGE GYIEKSLDKL
    260 270 280 290 300
    KGNKSYVNMD LSPVVECMDH ALTSLFPKTH YAAGKDAKIF WIPLSHMPAA
    310
    LQDFLLLKQK AELANPKAV
    Length:319
    Mass (Da):35,227
    Last modified:June 1, 2001 - v1
    Checksum:iDEE8CD65E5C25C6F
    GO
    Isoform 2 (identifier: Q9BPW9-2) [UniParc]FASTAAdd to basket
    Also known as: Retinol dehydrogenase homolog isoform-2

    The sequence of this isoform differs from the canonical sequence as follows:
         1-147: Missing.

    Note: No experimental confirmation available.
    Show »
    Length:172
    Mass (Da):18,943
    Checksum:i463DDCEE1084DD43
    GO
    Isoform 3 (identifier: Q9BPW9-3) [UniParc]FASTAAdd to basket
    Also known as: Retinol dehydrogenase homolog isoform-1

    The sequence of this isoform differs from the canonical sequence as follows:
         206-246: PGLFKTNLADPVKVIEKKLAIWEQLSPDIKQQYGEGYIEKS → R

    Note: No experimental confirmation available.
    Show »
    Length:279
    Mass (Da):30,726
    Checksum:iB3E2180767B0759E
    GO
    Isoform 4 (identifier: Q9BPW9-4) [UniParc]FASTAAdd to basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-1: M → MPEGRSHCACSITSLTLLVSLTRVTLDILQKLDPPQPAHWRHHLLVLYKKGVYLSHTGGKM

    Note: No experimental confirmation available.
    Show »
    Length:379
    Mass (Da):41,927
    Checksum:i4298C15F253128A0
    GO

    Experimental Info

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    Sequence conflicti162V → G in AAF82747 (Ref. 5) Curated1
    Sequence conflicti194M → L in AAF82747 (Ref. 5) Curated1

    Natural variant

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    Natural variantiVAR_052320286D → H. Corresponds to variant dbSNP:rs11695788Ensembl.1

    Alternative sequence

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    Alternative sequenceiVSP_0158751 – 147Missing in isoform 2. 1 PublicationAdd BLAST147
    Alternative sequenceiVSP_0543571M → MPEGRSHCACSITSLTLLVS LTRVTLDILQKLDPPQPAHW RHHLLVLYKKGVYLSHTGGK M in isoform 4. 1 Publication1
    Alternative sequenceiVSP_015876206 – 246PGLFK…YIEKS → R in isoform 3. 1 PublicationAdd BLAST41

    Sequence databases

    Select the link destinations:
    EMBLi
    GenBanki
    DDBJi
    Links Updated
    AF343729 mRNA Translation: AAK37528.1
    AY017349 mRNA Translation: AAG49422.1
    AF529286 mRNA Translation: AAN04008.1
    AF529287 mRNA Translation: AAN04009.1
    AF529288 mRNA Translation: AAN04010.1
    AF295380 mRNA Translation: AAL37037.1
    AF240697 mRNA Translation: AAF82747.1
    AF240698 mRNA Translation: AAF82748.1
    AY359046 mRNA Translation: AAQ89405.1
    AK296625 mRNA Translation: BAH12402.1
    AC007556 Genomic DNA No translation available.
    AC008177 Genomic DNA No translation available.
    CH471058 Genomic DNA Translation: EAX11282.1
    CH471058 Genomic DNA Translation: EAX11283.1
    CH471058 Genomic DNA Translation: EAX11284.1
    BC058883 mRNA Translation: AAH58883.1
    CCDSiCCDS2231.1 [Q9BPW9-1]
    CCDS74600.1 [Q9BPW9-4]
    RefSeqiNP_001135742.1, NM_001142270.1 [Q9BPW9-1]
    NP_001135743.1, NM_001142271.1 [Q9BPW9-1]
    NP_001276692.1, NM_001289763.1 [Q9BPW9-4]
    NP_954674.1, NM_199204.1 [Q9BPW9-1]
    XP_011508777.1, XM_011510475.1 [Q9BPW9-1]
    UniGeneiHs.179608

    Genome annotation databases

    EnsembliENST00000357546; ENSP00000350154; ENSG00000073737 [Q9BPW9-1]
    ENST00000412271; ENSP00000407747; ENSG00000073737 [Q9BPW9-1]
    ENST00000421653; ENSP00000388066; ENSG00000073737 [Q9BPW9-2]
    ENST00000428522; ENSP00000388564; ENSG00000073737 [Q9BPW9-1]
    ENST00000432060; ENSP00000389241; ENSG00000073737 [Q9BPW9-4]
    ENST00000436483; ENSP00000407167; ENSG00000073737 [Q9BPW9-1]
    ENST00000602501; ENSP00000473337; ENSG00000073737 [Q9BPW9-1]
    GeneIDi10170
    KEGGihsa:10170
    UCSCiuc002ueq.3 human [Q9BPW9-1]

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Similar proteinsi

    Entry informationi

    Entry nameiDHRS9_HUMAN
    AccessioniPrimary (citable) accession number: Q9BPW9
    Secondary accession number(s): B7Z416
    , D3DPC1, Q5RKX1, Q9NRA9, Q9NRB0
    Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 25, 2005
    Last sequence update: June 1, 2001
    Last modified: July 18, 2018
    This is version 149 of the entry and version 1 of the sequence. See complete history.
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 2
      Human chromosome 2: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. SIMILARITY comments
      Index of protein domains and families

    We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

    Do not show this banner again
    UniProt is an ELIXIR core data resource
    Main funding by: National Institutes of Health