Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 154 (13 Feb 2019)
Sequence version 1 (01 Jun 2001)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Dehydrogenase/reductase SDR family member 9

Gene

DHRS9

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

3-alpha-hydroxysteroid dehydrogenase that converts 3-alpha-tetrahydroprogesterone (allopregnanolone) to dihydroxyprogesterone and 3-alpha-androstanediol to dihydroxyprogesterone. May play a role in the biosynthesis of retinoic acid from retinaldehyde, but seems to have low activity with retinoids. Can utilize both NADH and NADPH.3 Publications

<p>This subsection of the ‘Function’ section describes biophysical and chemical properties, such as maximal absorption, kinetic parameters, pH dependence, redox potentials and temperature dependence.<p><a href='/help/biophysicochemical_properties' target='_top'>More...</a></p>Kineticsi

  1. KM=9 µM for NADH1 Publication
  2. KM=72 µM for NAD1 Publication
  3. KM=5 µM for allopregnanolone1 Publication
  4. KM=7.5 µM for 3-alpha-androstanediol1 Publication
  5. KM=24 µM for androsterone1 Publication
  6. KM=12 µM for dihydrotestosterone1 Publication

    Sites

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the ‘Function’ section describes the interaction between a single amino acid and another chemical entity. Priority is given to the annotation of physiological ligands.<p><a href='/help/binding' target='_top'>More...</a></p>Binding sitei83NADBy similarity1
    Binding sitei164SubstrateBy similarity1
    <p>This subsection of the ‘Function’ section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei176Proton acceptorBy similarity1
    Binding sitei180NADBy similarity1

    Regions

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the ‘Function’ section describes a region in the protein which binds nucleotide phosphates. It always involves more than one amino acid and includes all residues involved in nucleotide-binding.<p><a href='/help/np_bind' target='_top'>More...</a></p>Nucleotide bindingi34 – 58NADBy similarityAdd BLAST25

    <p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

    • alcohol dehydrogenase (NAD) activity Source: UniProtKB
    • racemase and epimerase activity Source: UniProtKB
    • retinol dehydrogenase activity Source: UniProtKB
    • testosterone dehydrogenase (NAD+) activity Source: UniProtKB

    GO - Biological processi

    <p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

    Molecular functionOxidoreductase
    LigandNAD, NADP

    Enzyme and pathway databases

    BioCyc Collection of Pathway/Genome Databases

    More...
    BioCyci
    MetaCyc:HS01113-MONOMER

    Reactome - a knowledgebase of biological pathways and processes

    More...
    Reactomei
    R-HSA-2453902 The canonical retinoid cycle in rods (twilight vision)
    R-HSA-5365859 RA biosynthesis pathway

    SABIO-RK: Biochemical Reaction Kinetics Database

    More...
    SABIO-RKi
    Q9BPW9

    Chemistry databases

    SwissLipids knowledge resource for lipid biology

    More...
    SwissLipidsi
    SLP:000000793

    <p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

    <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
    Recommended name:
    Dehydrogenase/reductase SDR family member 9 (EC:1.1.-.-)
    Alternative name(s):
    3-alpha hydroxysteroid dehydrogenase
    Short name:
    3-alpha-HSD
    NADP-dependent retinol dehydrogenase/reductase
    RDH-E2
    RDHL
    Retinol dehydrogenase 15
    Short chain dehydrogenase/reductase family 9C member 4
    Short-chain dehydrogenase/reductase retSDR8
    Tracheobronchial epithelial cell-specific retinol dehydrogenase
    Short name:
    RDH-TBE
    <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
    Name:DHRS9
    Synonyms:RDH15, SDR9C4
    ORF Names:UNQ835/PRO1773
    <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
    <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
    <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
    • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 2

    Organism-specific databases

    Eukaryotic Pathogen Database Resources

    More...
    EuPathDBi
    HostDB:ENSG00000073737.16

    Human Gene Nomenclature Database

    More...
    HGNCi
    HGNC:16888 DHRS9

    Online Mendelian Inheritance in Man (OMIM)

    More...
    MIMi
    612131 gene

    neXtProt; the human protein knowledge platform

    More...
    neXtProti
    NX_Q9BPW9

    <p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

    Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

    Keywords - Cellular componenti

    Endoplasmic reticulum, Membrane, Microsome

    <p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

    Organism-specific databases

    DisGeNET

    More...
    DisGeNETi
    10170

    Open Targets

    More...
    OpenTargetsi
    ENSG00000073737

    The Pharmacogenetics and Pharmacogenomics Knowledge Base

    More...
    PharmGKBi
    PA134913654

    Chemistry databases

    ChEMBL database of bioactive drug-like small molecules

    More...
    ChEMBLi
    CHEMBL5974

    Polymorphism and mutation databases

    BioMuta curated single-nucleotide variation and disease association database

    More...
    BioMutai
    DHRS9

    Domain mapping of disease mutations (DMDM)

    More...
    DMDMi
    74752227

    <p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

    Molecule processing

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the ‘PTM / Processing’ section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 17Sequence analysisAdd BLAST17
    <p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000004261718 – 319Dehydrogenase/reductase SDR family member 9Add BLAST302

    Proteomic databases

    Encyclopedia of Proteome Dynamics

    More...
    EPDi
    Q9BPW9

    jPOST - Japan Proteome Standard Repository/Database

    More...
    jPOSTi
    Q9BPW9

    MaxQB - The MaxQuant DataBase

    More...
    MaxQBi
    Q9BPW9

    PaxDb, a database of protein abundance averages across all three domains of life

    More...
    PaxDbi
    Q9BPW9

    PeptideAtlas

    More...
    PeptideAtlasi
    Q9BPW9

    PRoteomics IDEntifications database

    More...
    PRIDEi
    Q9BPW9

    ProteomicsDB human proteome resource

    More...
    ProteomicsDBi
    78582
    78583 [Q9BPW9-2]
    78584 [Q9BPW9-3]

    PTM databases

    Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

    More...
    PhosphoSitePlusi
    Q9BPW9

    <p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

    <p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

    Highly expressed in trachea and epidermis. Detected at lower levels in spinal cord, bone marrow, brain, tongue, esophagus, heart, colon, testis, placenta, lung, skeletal muscle and lymph node.3 Publications

    Gene expression databases

    Bgee dataBase for Gene Expression Evolution

    More...
    Bgeei
    ENSG00000073737 Expressed in 172 organ(s), highest expression level in nasal cavity epithelium

    ExpressionAtlas, Differential and Baseline Expression

    More...
    ExpressionAtlasi
    Q9BPW9 baseline and differential

    Genevisible search portal to normalized and curated expression data from Genevestigator

    More...
    Genevisiblei
    Q9BPW9 HS

    Organism-specific databases

    Human Protein Atlas

    More...
    HPAi
    HPA036491
    HPA036667

    <p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

    <p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

    Homotetramer.By similarity

    Protein-protein interaction databases

    The Biological General Repository for Interaction Datasets (BioGrid)

    More...
    BioGridi
    115472, 10 interactors

    Protein interaction database and analysis system

    More...
    IntActi
    Q9BPW9, 2 interactors

    STRING: functional protein association networks

    More...
    STRINGi
    9606.ENSP00000316670

    Chemistry databases

    BindingDB database of measured binding affinities

    More...
    BindingDBi
    Q9BPW9

    <p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

    3D structure databases

    Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

    More...
    ProteinModelPortali
    Q9BPW9

    SWISS-MODEL Repository - a database of annotated 3D protein structure models

    More...
    SMRi
    Q9BPW9

    Database of comparative protein structure models

    More...
    ModBasei
    Search...

    MobiDB: a database of protein disorder and mobility annotations

    More...
    MobiDBi
    Search...

    <p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

    <p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

    Keywords - Domaini

    Signal

    Phylogenomic databases

    evolutionary genealogy of genes: Non-supervised Orthologous Groups

    More...
    eggNOGi
    KOG1610 Eukaryota
    ENOG410Y7FK LUCA

    Ensembl GeneTree

    More...
    GeneTreei
    ENSGT00940000158665

    The HOVERGEN Database of Homologous Vertebrate Genes

    More...
    HOVERGENi
    HBG005482

    InParanoid: Eukaryotic Ortholog Groups

    More...
    InParanoidi
    Q9BPW9

    KEGG Orthology (KO)

    More...
    KOi
    K11149

    Identification of Orthologs from Complete Genome Data

    More...
    OMAi
    KLAIWKH

    Database of Orthologous Groups

    More...
    OrthoDBi
    1313182at2759

    Database for complete collections of gene phylogenies

    More...
    PhylomeDBi
    Q9BPW9

    TreeFam database of animal gene trees

    More...
    TreeFami
    TF325617

    Family and domain databases

    Integrated resource of protein families, domains and functional sites

    More...
    InterProi
    View protein in InterPro
    IPR036291 NAD(P)-bd_dom_sf
    IPR002347 SDR_fam

    Pfam protein domain database

    More...
    Pfami
    View protein in Pfam
    PF00106 adh_short, 1 hit

    Protein Motif fingerprint database; a protein domain database

    More...
    PRINTSi
    PR00081 GDHRDH
    PR00080 SDRFAMILY

    Superfamily database of structural and functional annotation

    More...
    SUPFAMi
    SSF51735 SSF51735, 1 hit

    <p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

    <p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

    <p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 4 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

    This entry has 4 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

    Isoform 1 (identifier: Q9BPW9-1) [UniParc]FASTAAdd to basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide
            10         20         30         40         50
    MLFWVLGLLI LCGFLWTRKG KLKIEDITDK YIFITGCDSG FGNLAARTFD
    60 70 80 90 100
    KKGFHVIAAC LTESGSTALK AETSERLRTV LLDVTDPENV KRTAQWVKNQ
    110 120 130 140 150
    VGEKGLWGLI NNAGVPGVLA PTDWLTLEDY REPIEVNLFG LISVTLNMLP
    160 170 180 190 200
    LVKKAQGRVI NVSSVGGRLA IVGGGYTPSK YAVEGFNDSL RRDMKAFGVH
    210 220 230 240 250
    VSCIEPGLFK TNLADPVKVI EKKLAIWEQL SPDIKQQYGE GYIEKSLDKL
    260 270 280 290 300
    KGNKSYVNMD LSPVVECMDH ALTSLFPKTH YAAGKDAKIF WIPLSHMPAA
    310
    LQDFLLLKQK AELANPKAV
    Length:319
    Mass (Da):35,227
    Last modified:June 1, 2001 - v1
    <p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iDEE8CD65E5C25C6F
    GO
    Isoform 2 (identifier: Q9BPW9-2) [UniParc]FASTAAdd to basket
    Also known as: Retinol dehydrogenase homolog isoform-2

    The sequence of this isoform differs from the canonical sequence as follows:
         1-147: Missing.

    Note: No experimental confirmation available.
    Show »
    Length:172
    Mass (Da):18,943
    Checksum:i463DDCEE1084DD43
    GO
    Isoform 3 (identifier: Q9BPW9-3) [UniParc]FASTAAdd to basket
    Also known as: Retinol dehydrogenase homolog isoform-1

    The sequence of this isoform differs from the canonical sequence as follows:
         206-246: PGLFKTNLADPVKVIEKKLAIWEQLSPDIKQQYGEGYIEKS → R

    Note: No experimental confirmation available.
    Show »
    Length:279
    Mass (Da):30,726
    Checksum:iB3E2180767B0759E
    GO
    Isoform 4 (identifier: Q9BPW9-4) [UniParc]FASTAAdd to basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-1: M → MPEGRSHCACSITSLTLLVSLTRVTLDILQKLDPPQPAHWRHHLLVLYKKGVYLSHTGGKM

    Note: No experimental confirmation available.
    Show »
    Length:379
    Mass (Da):41,927
    Checksum:i4298C15F253128A0
    GO

    <p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

    There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
    EntryEntry nameProtein names
    Gene namesLengthAnnotation
    C9J430C9J430_HUMAN
    Dehydrogenase/reductase SDR family ...
    DHRS9
    66Annotation score:

    Annotation score:1 out of 5

    <p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

    Experimental Info

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti162V → G in AAF82747 (Ref. 5) Curated1
    Sequence conflicti194M → L in AAF82747 (Ref. 5) Curated1

    Natural variant

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_052320286D → H. Corresponds to variant dbSNP:rs11695788Ensembl.1

    Alternative sequence

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0158751 – 147Missing in isoform 2. 1 PublicationAdd BLAST147
    Alternative sequenceiVSP_0543571M → MPEGRSHCACSITSLTLLVS LTRVTLDILQKLDPPQPAHW RHHLLVLYKKGVYLSHTGGK M in isoform 4. 1 Publication1
    Alternative sequenceiVSP_015876206 – 246PGLFK…YIEKS → R in isoform 3. 1 PublicationAdd BLAST41

    Sequence databases

    Select the link destinations:

    EMBL nucleotide sequence database

    More...
    EMBLi

    GenBank nucleotide sequence database

    More...
    GenBanki

    DNA Data Bank of Japan; a nucleotide sequence database

    More...
    DDBJi
    Links Updated
    AF343729 mRNA Translation: AAK37528.1
    AY017349 mRNA Translation: AAG49422.1
    AF529286 mRNA Translation: AAN04008.1
    AF529287 mRNA Translation: AAN04009.1
    AF529288 mRNA Translation: AAN04010.1
    AF295380 mRNA Translation: AAL37037.1
    AF240697 mRNA Translation: AAF82747.1
    AF240698 mRNA Translation: AAF82748.1
    AY359046 mRNA Translation: AAQ89405.1
    AK296625 mRNA Translation: BAH12402.1
    AC007556 Genomic DNA No translation available.
    AC008177 Genomic DNA No translation available.
    CH471058 Genomic DNA Translation: EAX11282.1
    CH471058 Genomic DNA Translation: EAX11283.1
    CH471058 Genomic DNA Translation: EAX11284.1
    BC058883 mRNA Translation: AAH58883.1

    The Consensus CDS (CCDS) project

    More...
    CCDSi
    CCDS2231.1 [Q9BPW9-1]
    CCDS74600.1 [Q9BPW9-4]

    NCBI Reference Sequences

    More...
    RefSeqi
    NP_001135742.1, NM_001142270.1 [Q9BPW9-1]
    NP_001135743.1, NM_001142271.1 [Q9BPW9-1]
    NP_001276692.1, NM_001289763.1 [Q9BPW9-4]
    NP_954674.1, NM_199204.1 [Q9BPW9-1]
    XP_011508777.1, XM_011510475.1 [Q9BPW9-1]

    UniGene gene-oriented nucleotide sequence clusters

    More...
    UniGenei
    Hs.179608

    Genome annotation databases

    Ensembl eukaryotic genome annotation project

    More...
    Ensembli
    ENST00000357546; ENSP00000350154; ENSG00000073737 [Q9BPW9-1]
    ENST00000412271; ENSP00000407747; ENSG00000073737 [Q9BPW9-1]
    ENST00000421653; ENSP00000388066; ENSG00000073737 [Q9BPW9-2]
    ENST00000428522; ENSP00000388564; ENSG00000073737 [Q9BPW9-1]
    ENST00000432060; ENSP00000389241; ENSG00000073737 [Q9BPW9-4]
    ENST00000436483; ENSP00000407167; ENSG00000073737 [Q9BPW9-1]
    ENST00000602501; ENSP00000473337; ENSG00000073737 [Q9BPW9-1]

    Database of genes from NCBI RefSeq genomes

    More...
    GeneIDi
    10170

    KEGG: Kyoto Encyclopedia of Genes and Genomes

    More...
    KEGGi
    hsa:10170

    UCSC genome browser

    More...
    UCSCi
    uc002ueq.3 human [Q9BPW9-1]

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    <p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

    <p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBLi
    GenBanki
    DDBJi
    Links Updated
    AF343729 mRNA Translation: AAK37528.1
    AY017349 mRNA Translation: AAG49422.1
    AF529286 mRNA Translation: AAN04008.1
    AF529287 mRNA Translation: AAN04009.1
    AF529288 mRNA Translation: AAN04010.1
    AF295380 mRNA Translation: AAL37037.1
    AF240697 mRNA Translation: AAF82747.1
    AF240698 mRNA Translation: AAF82748.1
    AY359046 mRNA Translation: AAQ89405.1
    AK296625 mRNA Translation: BAH12402.1
    AC007556 Genomic DNA No translation available.
    AC008177 Genomic DNA No translation available.
    CH471058 Genomic DNA Translation: EAX11282.1
    CH471058 Genomic DNA Translation: EAX11283.1
    CH471058 Genomic DNA Translation: EAX11284.1
    BC058883 mRNA Translation: AAH58883.1
    CCDSiCCDS2231.1 [Q9BPW9-1]
    CCDS74600.1 [Q9BPW9-4]
    RefSeqiNP_001135742.1, NM_001142270.1 [Q9BPW9-1]
    NP_001135743.1, NM_001142271.1 [Q9BPW9-1]
    NP_001276692.1, NM_001289763.1 [Q9BPW9-4]
    NP_954674.1, NM_199204.1 [Q9BPW9-1]
    XP_011508777.1, XM_011510475.1 [Q9BPW9-1]
    UniGeneiHs.179608

    3D structure databases

    ProteinModelPortaliQ9BPW9
    SMRiQ9BPW9
    ModBaseiSearch...
    MobiDBiSearch...

    Protein-protein interaction databases

    BioGridi115472, 10 interactors
    IntActiQ9BPW9, 2 interactors
    STRINGi9606.ENSP00000316670

    Chemistry databases

    BindingDBiQ9BPW9
    ChEMBLiCHEMBL5974
    SwissLipidsiSLP:000000793

    PTM databases

    PhosphoSitePlusiQ9BPW9

    Polymorphism and mutation databases

    BioMutaiDHRS9
    DMDMi74752227

    Proteomic databases

    EPDiQ9BPW9
    jPOSTiQ9BPW9
    MaxQBiQ9BPW9
    PaxDbiQ9BPW9
    PeptideAtlasiQ9BPW9
    PRIDEiQ9BPW9
    ProteomicsDBi78582
    78583 [Q9BPW9-2]
    78584 [Q9BPW9-3]

    Protocols and materials databases

    The DNASU plasmid repository

    More...
    DNASUi
    10170
    Structural Biology KnowledgebaseSearch...

    Genome annotation databases

    EnsembliENST00000357546; ENSP00000350154; ENSG00000073737 [Q9BPW9-1]
    ENST00000412271; ENSP00000407747; ENSG00000073737 [Q9BPW9-1]
    ENST00000421653; ENSP00000388066; ENSG00000073737 [Q9BPW9-2]
    ENST00000428522; ENSP00000388564; ENSG00000073737 [Q9BPW9-1]
    ENST00000432060; ENSP00000389241; ENSG00000073737 [Q9BPW9-4]
    ENST00000436483; ENSP00000407167; ENSG00000073737 [Q9BPW9-1]
    ENST00000602501; ENSP00000473337; ENSG00000073737 [Q9BPW9-1]
    GeneIDi10170
    KEGGihsa:10170
    UCSCiuc002ueq.3 human [Q9BPW9-1]

    Organism-specific databases

    Comparative Toxicogenomics Database

    More...
    CTDi
    10170
    DisGeNETi10170
    EuPathDBiHostDB:ENSG00000073737.16

    GeneCards: human genes, protein and diseases

    More...
    GeneCardsi
    DHRS9
    HGNCiHGNC:16888 DHRS9
    HPAiHPA036491
    HPA036667
    MIMi612131 gene
    neXtProtiNX_Q9BPW9
    OpenTargetsiENSG00000073737
    PharmGKBiPA134913654

    GenAtlas: human gene database

    More...
    GenAtlasi
    Search...

    Phylogenomic databases

    eggNOGiKOG1610 Eukaryota
    ENOG410Y7FK LUCA
    GeneTreeiENSGT00940000158665
    HOVERGENiHBG005482
    InParanoidiQ9BPW9
    KOiK11149
    OMAiKLAIWKH
    OrthoDBi1313182at2759
    PhylomeDBiQ9BPW9
    TreeFamiTF325617

    Enzyme and pathway databases

    BioCyciMetaCyc:HS01113-MONOMER
    ReactomeiR-HSA-2453902 The canonical retinoid cycle in rods (twilight vision)
    R-HSA-5365859 RA biosynthesis pathway
    SABIO-RKiQ9BPW9

    Miscellaneous databases

    The Gene Wiki collection of pages on human genes and proteins

    More...
    GeneWikii
    DHRS9

    Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

    More...
    GenomeRNAii
    10170

    Protein Ontology

    More...
    PROi
    PR:Q9BPW9

    The Stanford Online Universal Resource for Clones and ESTs

    More...
    SOURCEi
    Search...

    Gene expression databases

    BgeeiENSG00000073737 Expressed in 172 organ(s), highest expression level in nasal cavity epithelium
    ExpressionAtlasiQ9BPW9 baseline and differential
    GenevisibleiQ9BPW9 HS

    Family and domain databases

    InterProiView protein in InterPro
    IPR036291 NAD(P)-bd_dom_sf
    IPR002347 SDR_fam
    PfamiView protein in Pfam
    PF00106 adh_short, 1 hit
    PRINTSiPR00081 GDHRDH
    PR00080 SDRFAMILY
    SUPFAMiSSF51735 SSF51735, 1 hit

    ProtoNet; Automatic hierarchical classification of proteins

    More...
    ProtoNeti
    Search...

    <p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

    <p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiDHRS9_HUMAN
    <p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9BPW9
    Secondary accession number(s): B7Z416
    , D3DPC1, Q5RKX1, Q9NRA9, Q9NRB0
    <p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 25, 2005
    Last sequence update: June 1, 2001
    Last modified: February 13, 2019
    This is version 154 of the entry and version 1 of the sequence. See complete history.
    <p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    <p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. SIMILARITY comments
      Index of protein domains and families
    2. Human chromosome 2
      Human chromosome 2: entries, gene names and cross-references to MIM
    3. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    4. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    5. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    UniProt is an ELIXIR core data resource
    Main funding by: National Institutes of Health

    We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

    Do not show this banner again