Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 128 (13 Feb 2019)
Sequence version 1 (01 Jun 2001)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Agamous-like MADS-box protein AGL27

Gene

AGL27

Organism
Arabidopsis thaliana (Mouse-ear cress)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Probable transcription factor involved in the negative regulation of flowering time in both long and short days, probably through the photoperiodic and vernalization pathways. Prevents premature flowering.4 Publications

Miscellaneous

The early flowering of cv. Nd-1 (especially in short days) is due to a deletion of AGL27. This deletion is associated with the QTL 'FLOWERING 1' (FLW1) (PubMed:15695584).1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionDevelopmental protein, DNA-binding
Biological processFlowering, Transcription, Transcription regulation

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Agamous-like MADS-box protein AGL27
Alternative name(s):
MADS box FLC1-like nuclear protein
Protein FLOWERING LOCUS M
Protein MADS AFFECTING FLOWERING 1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:AGL27
Synonyms:FK1, FLM, MAF1
Ordered Locus Names:At1g77080
ORF Names:F22K20.15
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiArabidopsis thaliana (Mouse-ear cress)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri3702 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaViridiplantaeStreptophytaEmbryophytaTracheophytaSpermatophytaMagnoliophytaeudicotyledonsGunneridaePentapetalaerosidsmalvidsBrassicalesBrassicaceaeCamelineaeArabidopsis
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000006548 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 1

Organism-specific databases

Arabidopsis Information Portal

More...
Araporti
AT1G77080

The Arabidopsis Information Resource

More...
TAIRi
locus:2025282 AT1G77080

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cell wall Cytoskeleton Vacuole Chloroplast Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertion Graphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the ‘Pathology and Biotech’ section describes the in vivo effects caused by ablation of the gene (or one or more transcripts) coding for the protein described in the entry. This includes gene knockout and knockdown, provided experiments have been performed in the context of a whole organism or a specific tissue, and not at the single-cell level.<p><a href='/help/disruption_phenotype' target='_top'>More...</a></p>Disruption phenotypei

Suppress the late-flowering phenotype of photoperiod-pathway mutants. Affects natural variation in flowering behavior in both long and short days.3 Publications

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00004125321 – 196Agamous-like MADS-box protein AGL27Add BLAST196

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9AT76

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in most plant tissues, embryo, seedlings, roots, leaves, stems, inflorescence, pollen, siliques and flowers.4 Publications

<p>This subsection of the ‘Expression’ section reports the experimentally proven effects of inducers and repressors (usually chemical compounds or environmental factors) on the level of protein (or mRNA) expression (up-regulation, down-regulation, constitutive expression).<p><a href='/help/induction' target='_top'>More...</a></p>Inductioni

Slightly repressed by vernalization. Negatively regulated at the chromatin level by VIL1 through the photoperiod and vernalization pathways. Requires EARLY FLOWERING 7 (ELF7) and ELF8 to be expressed. Up-regulated by HUA2.4 Publications

Gene expression databases

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q9AT76 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9AT76 AT

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with AGL39, AGL97 and AGL74.1 Publication

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
29261, 15 interactors

Database of interacting proteins

More...
DIPi
DIP-33758N

Protein interaction database and analysis system

More...
IntActi
Q9AT76, 25 interactors

STRING: functional protein association networks

More...
STRINGi
3702.AT1G77080.4

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
Q9AT76

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q9AT76

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini1 – 61MADS-boxPROSITE-ProRule annotationAdd BLAST61
Domaini80 – 170K-boxPROSITE-ProRule annotationAdd BLAST91

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG0014 Eukaryota
COG5068 LUCA

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000155301

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9AT76

Identification of Orthologs from Complete Genome Data

More...
OMAi
ITQCFEL

Database of Orthologous Groups

More...
OrthoDBi
1433397at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9AT76

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
3.40.1810.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR002487 TF_Kbox
IPR002100 TF_MADSbox
IPR036879 TF_MADSbox_sf

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF01486 K-box, 1 hit
PF00319 SRF-TF, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR00404 MADSDOMAIN

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00432 MADS, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF55455 SSF55455, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS51297 K_BOX, 1 hit
PS50066 MADS_BOX_2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 7 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9AT76-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MGRRKIEIKR IENKSSRQVT FSKRRNGLID KARQLSILCE SSVAVVVVSA
60 70 80 90 100
SGKLYDSSSG DDISKIIDRY EIQHADELRA LDLEEKIQNY LPHKELLETV
110 120 130 140 150
QSKLEEPNVD NVSVDSLISL EEQLETALSV SRARKAELMM EYIESLKEKE
160 170 180 190
KLLREENQVL ASQMGKNTLL ATDDERGMFP GSSSGNKIPE TLPLLN
Length:196
Mass (Da):22,119
Last modified:June 1, 2001 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i8A9EEEE7085236DD
GO
Isoform 2 (identifier: Q9AT76-2) [UniParc]FASTAAdd to basket
Also known as: AGL27-I

The sequence of this isoform differs from the canonical sequence as follows:
     164-173: MGKNTLLATD → LSEKKGMSHR
     174-196: Missing.

Note: No experimental confirmation available.
Show »
Length:173
Mass (Da):19,787
Checksum:i07422E88B307A818
GO
Isoform 3 (identifier: Q9AT76-3) [UniParc]FASTAAdd to basket
Also known as: AGL27-II

The sequence of this isoform differs from the canonical sequence as follows:
     62-80: DISKIIDRYEIQHADELRA → EIEALFKPEKPQCFE

Note: No experimental confirmation available.
Show »
Length:192
Mass (Da):21,642
Checksum:i7D4B0B34C74B7E5B
GO
Isoform 4 (identifier: Q9AT76-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-62: MGRRKIEIKRIENKSSRQVTFSKRRNGLIDKARQLSILCESSVAVVVVSASGKLYDSSSGDD → MHFCFISS
     101-101: Q → QRLAVRHIFLPSSSDKKNVFFLLSTCEY
     150-168: EKLLREENQVLASQMGKNT → VSALVFIFDKGHILGYDDS
     169-196: Missing.

Note: No experimental confirmation available.
Show »
Length:141
Mass (Da):16,326
Checksum:i2C3AF9F13DD381B5
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 7 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A1P8ARE3A0A1P8ARE3_ARATH
K-box region and MADS-box transcrip...
MAF1 AGAMOUS-like 27, AGL27, FLM, FLOWERING LOCUS M, MADS AFFECTING FLOWERING 1
176Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A1P8ARA3A0A1P8ARA3_ARATH
K-box region and MADS-box transcrip...
MAF1 AGAMOUS-like 27, AGL27, FLM, FLOWERING LOCUS M, MADS AFFECTING FLOWERING 1
223Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A1P8ARA9A0A1P8ARA9_ARATH
K-box region and MADS-box transcrip...
MAF1 AGAMOUS-like 27, AGL27, FLM, FLOWERING LOCUS M, MADS AFFECTING FLOWERING 1
148Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A1P8ARA1A0A1P8ARA1_ARATH
K-box region and MADS-box transcrip...
MAF1 AGAMOUS-like 27, AGL27, FLM, FLOWERING LOCUS M, MADS AFFECTING FLOWERING 1
142Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A1P8ARC3A0A1P8ARC3_ARATH
K-box region and MADS-box transcrip...
MAF1 AGAMOUS-like 27, AGL27, FLM, FLOWERING LOCUS M, MADS AFFECTING FLOWERING 1
149Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A1P8ARA2A0A1P8ARA2_ARATH
K-box region and MADS-box transcrip...
MAF1 AGAMOUS-like 27, AGL27, FLM, FLOWERING LOCUS M, MADS AFFECTING FLOWERING 1
169Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A1P8ARB5A0A1P8ARB5_ARATH
K-box region and MADS-box transcrip...
MAF1 AGAMOUS-like 27, AGL27, FLM, FLOWERING LOCUS M, MADS AFFECTING FLOWERING 1
122Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAC00628 differs from that shown. Reason: Erroneous gene model prediction.Curated

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0416921 – 62MGRRK…SSGDD → MHFCFISS in isoform 4. 1 PublicationAdd BLAST62
Alternative sequenceiVSP_04169362 – 80DISKI…DELRA → EIEALFKPEKPQCFE in isoform 3. 1 PublicationAdd BLAST19
Alternative sequenceiVSP_041694101Q → QRLAVRHIFLPSSSDKKNVF FLLSTCEY in isoform 4. 1 Publication1
Alternative sequenceiVSP_041695150 – 168EKLLR…MGKNT → VSALVFIFDKGHILGYDDS in isoform 4. 1 PublicationAdd BLAST19
Alternative sequenceiVSP_041696164 – 173MGKNTLLATD → LSEKKGMSHR in isoform 2. 1 Publication10
Alternative sequenceiVSP_041697169 – 196Missing in isoform 4. 1 PublicationAdd BLAST28
Alternative sequenceiVSP_041698174 – 196Missing in isoform 2. 1 PublicationAdd BLAST23

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF312665 mRNA Translation: AAG37902.1
AF312666 mRNA Translation: AAG37903.1
AF342808 mRNA Translation: AAK37527.1
AY141210 mRNA Translation: AAN52774.1
AY034083 mRNA Translation: AAK54440.1
AC002291 Genomic DNA Translation: AAC00628.1 Sequence problems.
CP002684 Genomic DNA Translation: AEE35929.1
CP002684 Genomic DNA Translation: AEE35930.1
CP002684 Genomic DNA Translation: AEE35931.1
CP002684 Genomic DNA Translation: AEE35932.1
AK117577 mRNA Translation: BAC42235.1
BT004598 mRNA Translation: AAO42844.1
AK175247 mRNA Translation: BAD43010.1
AK176270 mRNA Translation: BAD44033.1
AK227948 mRNA Translation: BAE99916.1
AY088709 mRNA Translation: AAM67028.1

Protein sequence database of the Protein Information Resource

More...
PIRi
F96799

NCBI Reference Sequences

More...
RefSeqi
NP_177833.3, NM_106358.4 [Q9AT76-1]
NP_850979.1, NM_180648.3 [Q9AT76-3]
NP_850980.2, NM_180649.4 [Q9AT76-4]
NP_974160.2, NM_202431.2 [Q9AT76-2]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
At.19799

Genome annotation databases

Ensembl plant genome annotation project

More...
EnsemblPlantsi
AT1G77080.2; AT1G77080.2; AT1G77080 [Q9AT76-3]
AT1G77080.3; AT1G77080.3; AT1G77080 [Q9AT76-4]
AT1G77080.4; AT1G77080.4; AT1G77080 [Q9AT76-1]
AT1G77080.5; AT1G77080.5; AT1G77080 [Q9AT76-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
844042

Gramene; a comparative resource for plants

More...
Gramenei
AT1G77080.2; AT1G77080.2; AT1G77080 [Q9AT76-3]
AT1G77080.3; AT1G77080.3; AT1G77080 [Q9AT76-4]
AT1G77080.4; AT1G77080.4; AT1G77080 [Q9AT76-1]
AT1G77080.5; AT1G77080.5; AT1G77080 [Q9AT76-2]

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
ath:AT1G77080

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF312665 mRNA Translation: AAG37902.1
AF312666 mRNA Translation: AAG37903.1
AF342808 mRNA Translation: AAK37527.1
AY141210 mRNA Translation: AAN52774.1
AY034083 mRNA Translation: AAK54440.1
AC002291 Genomic DNA Translation: AAC00628.1 Sequence problems.
CP002684 Genomic DNA Translation: AEE35929.1
CP002684 Genomic DNA Translation: AEE35930.1
CP002684 Genomic DNA Translation: AEE35931.1
CP002684 Genomic DNA Translation: AEE35932.1
AK117577 mRNA Translation: BAC42235.1
BT004598 mRNA Translation: AAO42844.1
AK175247 mRNA Translation: BAD43010.1
AK176270 mRNA Translation: BAD44033.1
AK227948 mRNA Translation: BAE99916.1
AY088709 mRNA Translation: AAM67028.1
PIRiF96799
RefSeqiNP_177833.3, NM_106358.4 [Q9AT76-1]
NP_850979.1, NM_180648.3 [Q9AT76-3]
NP_850980.2, NM_180649.4 [Q9AT76-4]
NP_974160.2, NM_202431.2 [Q9AT76-2]
UniGeneiAt.19799

3D structure databases

ProteinModelPortaliQ9AT76
SMRiQ9AT76
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi29261, 15 interactors
DIPiDIP-33758N
IntActiQ9AT76, 25 interactors
STRINGi3702.AT1G77080.4

Proteomic databases

PaxDbiQ9AT76

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsemblPlantsiAT1G77080.2; AT1G77080.2; AT1G77080 [Q9AT76-3]
AT1G77080.3; AT1G77080.3; AT1G77080 [Q9AT76-4]
AT1G77080.4; AT1G77080.4; AT1G77080 [Q9AT76-1]
AT1G77080.5; AT1G77080.5; AT1G77080 [Q9AT76-2]
GeneIDi844042
GrameneiAT1G77080.2; AT1G77080.2; AT1G77080 [Q9AT76-3]
AT1G77080.3; AT1G77080.3; AT1G77080 [Q9AT76-4]
AT1G77080.4; AT1G77080.4; AT1G77080 [Q9AT76-1]
AT1G77080.5; AT1G77080.5; AT1G77080 [Q9AT76-2]
KEGGiath:AT1G77080

Organism-specific databases

AraportiAT1G77080
TAIRilocus:2025282 AT1G77080

Phylogenomic databases

eggNOGiKOG0014 Eukaryota
COG5068 LUCA
HOGENOMiHOG000155301
InParanoidiQ9AT76
OMAiITQCFEL
OrthoDBi1433397at2759
PhylomeDBiQ9AT76

Miscellaneous databases

Protein Ontology

More...
PROi
PR:Q9AT76

Gene expression databases

ExpressionAtlasiQ9AT76 baseline and differential
GenevisibleiQ9AT76 AT

Family and domain databases

Gene3Di3.40.1810.10, 1 hit
InterProiView protein in InterPro
IPR002487 TF_Kbox
IPR002100 TF_MADSbox
IPR036879 TF_MADSbox_sf
PfamiView protein in Pfam
PF01486 K-box, 1 hit
PF00319 SRF-TF, 1 hit
PRINTSiPR00404 MADSDOMAIN
SMARTiView protein in SMART
SM00432 MADS, 1 hit
SUPFAMiSSF55455 SSF55455, 1 hit
PROSITEiView protein in PROSITE
PS51297 K_BOX, 1 hit
PS50066 MADS_BOX_2, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiAGL27_ARATH
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9AT76
Secondary accession number(s): O49291
, Q7XYY7, Q9FPN8, Q9FPN9
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: September 21, 2011
Last sequence update: June 1, 2001
Last modified: February 13, 2019
This is version 128 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programPlant Protein Annotation Program

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Arabidopsis thaliana
    Arabidopsis thaliana: entries and gene names
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again