Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 168 (29 Sep 2021)
Sequence version 3 (26 Jun 2013)
Previous versions | rss
Add a publicationFeedback
Protein

Protocadherin-15

Gene

Pcdh15

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Calcium-dependent cell-adhesion protein. Required for inner ear neuroepithelial cell elaboration and cochlear function. Probably involved in the maintenance of normal retinal function.

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processCell adhesion, Hearing
LigandCalcium

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Protocadherin-15
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Pcdh15
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 10

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:1891428, Pcdh15

Eukaryotic Pathogen, Vector and Host Database Resources

More...
VEuPathDBi
HostDB:ENSMUSG00000052613

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini27 – 1381ExtracellularSequence analysisAdd BLAST1355
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei1382 – 1402HelicalSequence analysisAdd BLAST21
Topological domaini1403 – 1943CytoplasmicSequence analysisAdd BLAST541

Keywords - Cellular componenti

Cell membrane, Membrane, Secreted

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the 'Pathology and Biotech' section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

Defects in Pcdh15 are the cause of the Ames waltzer (av) phenotype. It is characterized by deafness and a balance disorder, associated with the degeneration of inner ear neuroepithelia.

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi48I → A: Strongly reduced interaction with CDH23. 1 Publication1
Mutagenesisi139R → G: Impaired interaction with CDH23. 1 Publication1

Keywords - Diseasei

Deafness

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 26Sequence analysisAdd BLAST26
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000000399927 – 1943Protocadherin-15Add BLAST1917

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi37 ↔ 1251 Publication
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi57N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi102N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi206N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi424N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi564N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi667N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi729N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi773N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi826N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi856N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi1069N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi1089N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi1180N-linked (GlcNAc...) asparagineSequence analysis1

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q99PJ1

PRoteomics IDEntifications database

More...
PRIDEi
Q99PJ1

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
288267 [Q99PJ1-1]
288268 [Q99PJ1-2]
288269 [Q99PJ1-3]
288270 [Q99PJ1-4]
288271 [Q99PJ1-5]
288272 [Q99PJ1-6]
288273 [Q99PJ1-7]
288274 [Q99PJ1-8]
288275 [Q99PJ1-9]
288276 [Q99PJ1-10]
288277 [Q99PJ1-11]
288278 [Q99PJ1-12]
288279 [Q99PJ1-13]
289304 [Q99PJ1-14]
289305 [Q99PJ1-15]
289306 [Q99PJ1-16]
289307 [Q99PJ1-17]
289308 [Q99PJ1-18]
289309 [Q99PJ1-19]
289310 [Q99PJ1-20]
289311 [Q99PJ1-21]
289312 [Q99PJ1-22]
289313 [Q99PJ1-23]
289314 [Q99PJ1-24]
289315 [Q99PJ1-25]
289316 [Q99PJ1-26]

PTM databases

GlyGen: Computational and Informatics Resources for Glycoscience

More...
GlyGeni
Q99PJ1, 18 sites

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q99PJ1

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q99PJ1

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in brain and sensory epithelium of the developing inner ear. Expressed in the retina, in the photoreceptor inner segments, the outer plexiform layer, the inner nuclei layer and the ganglion cell layer and, more diffusely in the inner plexiform layer (at protein level). Not detected in the retinal pigment epithelium (at protein level). Expressed in the spleen, dorsal root ganglion, dorsal aspect of neural tube, floor plate and ependymal cells adjacent to the neural canal.4 Publications

<p>This subsection of the 'Expression' section provides information on the expression of the gene product at various stages of a cell, tissue or organism development. By default, the information is derived from experiments at the mRNA level, unless specified 'at the protein level'.<p><a href='/help/developmental_stage' target='_top'>More...</a></p>Developmental stagei

Highest level of expression is detected at embryonic day 16. Alternative splicing isoforms have different spatiotemporal expression patterns. In cochlear cultures at the equivalent of postnatal day 3, isoforms belonging to the CD1 (isoforms 1 through 9) and CD3 (isoforms 18 through 20) groups are highly expressed in hair bundles in the basal coils and moderately in those in the middle of the apical coil; they are hardly detectable in those at the apical end of the apical coil (at protein level). At the base of the cultured cochlea, in the more mature hair bundles, CD3 group isoforms are restricted to the tips of the shorter stereocilia in both inner and outer hair cells. By contrast, at the same stage, isoforms belonging to the CD2 group (isoforms 10 through 17) are highly expressed in hair bundles in the apex of the cochlea and, at lower levels, in those in the middle of the apical coil; they are hardly detectable at the base of the cochlea (at protein level). In mature hair bundles, CD1 group isoforms are distributed fairly evenly along most of the length of the stereocilia on auditory hair cells, whereas they are concentrated toward the upper third of the hair bundle in vestibular hair cells. In both the auditory and the vestibular organs, these isoforms are excluded from a region at the very tip of each stereocilium (at protein level). In contrast, CD2 group isoforms are undetectable in adult cochlear hair cells (at protein level). These isoforms are expressed in the entire hair bundle of the immature cells in the sensory epithelium of the early postnatal vestibule and only in the kinocilium in the more mature hair bundles (at protein level). CD3 group isoforms are detected in immature vestibular hair bundles, concentrated toward the tip of each stereocilium, as early as 15.5 dpc. They also localize to the tips of the shorter stereocilia in the mature vestibular hair bundles and are not detected at the tips of the stereocilia in the tallest row (at protein level).1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSMUSG00000052613, Expressed in brain and 169 other tissues

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q99PJ1, MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Antiparallel heterodimer with CDH23 (PubMed:23135401, PubMed:17805295).

Found in a complex with TMIE and LHFPL5 (PubMed:25467981).

Interacts with LHFPL5/TMHS; this interaction is required for efficient localization to hair bundles (PubMed:23217710).

Interacts with MYO7A (PubMed:16481439).

Interacts with USH1G; this interaction may recruit USH1G to the plasma membrane (PubMed:21436032).

Interacts with TOMT (PubMed:28504928). Isoforms CD1 and CD3 interact with TMC1 (via N-terminus) and TMC2 (via N-terminus) (PubMed:25114259).

8 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
198282, 3 interactors

Database of interacting proteins

More...
DIPi
DIP-42151N

Protein interaction database and analysis system

More...
IntActi
Q99PJ1, 3 interactors

Molecular INTeraction database

More...
MINTi
Q99PJ1

STRING: functional protein association networks

More...
STRINGi
10090.ENSMUSP00000101066

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q99PJ1, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

11943
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q99PJ1

Database of comparative protein structure models

More...
ModBasei
Search...

Protein Data Bank in Europe - Knowledge Base

More...
PDBe-KBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini45 – 152Cadherin 1PROSITE-ProRule annotationAdd BLAST108
Domaini153 – 270Cadherin 2PROSITE-ProRule annotationAdd BLAST118
Domaini283 – 400Cadherin 3PROSITE-ProRule annotationAdd BLAST118
Domaini401 – 514Cadherin 4PROSITE-ProRule annotationAdd BLAST114
Domaini515 – 621Cadherin 5PROSITE-ProRule annotationAdd BLAST107
Domaini622 – 722Cadherin 6PROSITE-ProRule annotationAdd BLAST101
Domaini724 – 824Cadherin 7PROSITE-ProRule annotationAdd BLAST101
Domaini825 – 931Cadherin 8PROSITE-ProRule annotationAdd BLAST107
Domaini932 – 1040Cadherin 9PROSITE-ProRule annotationAdd BLAST109
Domaini1042 – 1149Cadherin 10PROSITE-ProRule annotationAdd BLAST108
Domaini1150 – 1264Cadherin 11PROSITE-ProRule annotationAdd BLAST115

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni1425 – 1453DisorderedSequence analysisAdd BLAST29
Regioni1475 – 1533DisorderedSequence analysisAdd BLAST59
Regioni1714 – 1865DisorderedSequence analysisAdd BLAST152

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular type of amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi1430 – 1451Pro residuesSequence analysisAdd BLAST22
Compositional biasi1514 – 1533Polar residuesSequence analysisAdd BLAST20
Compositional biasi1714 – 1733Polar residuesSequence analysisAdd BLAST20
Compositional biasi1745 – 1784Pro residuesSequence analysisAdd BLAST40
Compositional biasi1791 – 1819Pro residuesSequence analysisAdd BLAST29
Compositional biasi1820 – 1857Polar residuesSequence analysisAdd BLAST38

<p>This subsection of the 'Family and domains' section provides general information on the biological role of a domain. The term 'domain' is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

Cadherin repeats 1 and 2 mediate calcium-dependent heterophilic interaction with CDH23.1 Publication
Three calcium ions are usually bound at the interface of each cadherin domain and rigidify the connections, imparting a strong curvature to the full-length ectodomain.1 Publication

Keywords - Domaini

Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG3594, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000156675

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_001945_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q99PJ1

Database of Orthologous Groups

More...
OrthoDBi
21247at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q99PJ1

TreeFam database of animal gene trees

More...
TreeFami
TF326779

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR002126, Cadherin-like_dom
IPR015919, Cadherin-like_sf
IPR020894, Cadherin_CS
IPR041149, EC_dom
IPR030718, Protocadherin-15

The PANTHER Classification System

More...
PANTHERi
PTHR24028:SF11, PTHR24028:SF11, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00028, Cadherin, 8 hits
PF18432, ECD, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR00205, CADHERIN

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00112, CA, 11 hits

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF49313, SSF49313, 10 hits

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00232, CADHERIN_1, 4 hits
PS50268, CADHERIN_2, 11 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (26+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 26 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 26 described isoforms and 5 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q99PJ1-1) [UniParc]FASTAAdd to basket
Also known as: CD1-1

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MFLQFAVWKC LPHGILIASL LVVSWGQYDD DWQYEDCKLA RGGPPATIVA
60 70 80 90 100
IDEESRNGTI LVDNMLIKGT AGGPDPTIEL SLKDNVDYWV LLDPVKQMLF
110 120 130 140 150
LNSTGRVLDR DPPMNIHSIV VQVQCVNKKV GTVIYHEVRI VVRDRNDNSP
160 170 180 190 200
TFKHESYYAT VNELTPVGTT IFTGFSGDNG ATDIDDGPNG QIEYVIQYNP
210 220 230 240 250
EDPTSNDTFE IPLMLTGNVV LRKRLNYEDK TRYYVIIQAN DRAQNLNERR
260 270 280 290 300
TTTTTLTVDV LDGDDLGPMF LPCVLVPNTR DCRPLTYQAA IPELRTPEEL
310 320 330 340 350
NPILVTPPIQ AIDQDRNIQP PSDRPGILYS ILVGTPEDYP RFFHMHPRTA
360 370 380 390 400
ELTLLEPVNR DFHQKFDLVI KAEQDNGHPL PAFASLHIEI LDENNQSPYF
410 420 430 440 450
TMPSYQGYIL ESAPVGATIS ESLNLTTPLR IVALDKDIED TKDPELHLFL
460 470 480 490 500
NDYTSVFTVT PTGITRYLTL LQPVDREEQQ TYTFLITAFD GVQESEPVVV
510 520 530 540 550
NIRVMDANDN TPTFPEISYD VYVYTDMSPG DSVIQLTAVD ADEGSNGEIS
560 570 580 590 600
YEILVGGKGD FVINKTTGLV SIAPGVELIV GQTYALTVQA SDNAPPAERR
610 620 630 640 650
HSICTVYIEV LPPNNQSPPR FPQLMYSLEV SEAMRIGAIL LNLQATDREG
660 670 680 690 700
DPITYAIENG DPQRVFNLSE TTGILSLGKA LDRESTDRYI LIVTASDGRP
710 720 730 740 750
DGTSTATVNI VVTDVNDNAP VFDPYLPRNL SVVEEEANAF VGQVRATDPD
760 770 780 790 800
AGINGQVHYS LGNFNNLFRI TSNGSIYTAV KLNREARDHY ELVVVATDGA
810 820 830 840 850
VHPRHSTLTL YIKVLDIDDN SPVFTNSTYT VVVEENLPAG TSFLQIEAKD
860 870 880 890 900
VDLGANVSYR IRSPEVKHLF ALHPFTGELS LLRSLDYEAF PDQEASITFL
910 920 930 940 950
VEAFDIYGTM PPGIATVTVI VKDMNDYPPV FSKRIYKGMV APDAVKGTPI
960 970 980 990 1000
TTVYAEDADP PGMPASRVRY RVDDVQFPYP ASIFDVEEDS GRVVTRVNLN
1010 1020 1030 1040 1050
EEPTTIFKLV VVAFDDGEPV MSSSATVRIL VLHPGEIPRF TQEEYRPPPV
1060 1070 1080 1090 1100
SELAARGTVV GVISAAAINQ SIVYSIVAGN EEDKFGINNV TGVIYVNSPL
1110 1120 1130 1140 1150
DYETRTSYVL RVQADSLEVV LANLRVPSKS NTAKVYIEIQ DENDHPPVFQ
1160 1170 1180 1190 1200
KKFYIGGVSE DARMFASVLR VKATDRDTGN YSAMAYRLII PPIKEGKEGF
1210 1220 1230 1240 1250
VVETYTGLIK TAMLFHNMRR SYFKFQVIAT DDYGKGLSGK ADVLVSVVNQ
1260 1270 1280 1290 1300
LDMQVIVSNV PPTLVEKKIE DLTEILDRYV QEQIPGAKVV VESIGARRHG
1310 1320 1330 1340 1350
DAYSLEDYSK CDLTVYAIDP QTNRAIDRNE LFKFLDGKLL DINKDFQPYY
1360 1370 1380 1390 1400
GEGGRILEIR TPEAVTSIKK RGESLGYTEG ALLALAFIII LCCIPAILVV
1410 1420 1430 1440 1450
LVSYRQFKVR QAECTKTARI QSAMPAAKPA APVPAAPAPP PPPPPPPPGA
1460 1470 1480 1490 1500
HLYEELGESA MHNLFLLYHF EQSRGNNSVP EDRSSHRDGM AFSSSTTESH
1510 1520 1530 1540 1550
EPAHVEGPLK ESQPNPARTF SFVPDEDNLS THNPLYMESI GQRSTNSDLQ
1560 1570 1580 1590 1600
PRTDFEELLA PRTQVKSQSL RGPREKIQRV WNQSVSFPRR LMWKAPNRPE
1610 1620 1630 1640 1650
TIDLVEWQIT NQRAECESAR CHPSQRGSSN VLLATEDAHE SEKEGGHRDT
1660 1670 1680 1690 1700
LIVQQTEQLK SLSSGSSFSS SWSHFSFSTL PTISRAVELG SEPNVVTSPA
1710 1720 1730 1740 1750
DCTLELSPPL RPRILNSLSS KRETPTCASD TEPKRNSFEI APHPPSISAP
1760 1770 1780 1790 1800
LPHPPLPRPP IAFTTFPLPL SPPNPPPPQL VTFSLPISTP PTSSLPLPPP
1810 1820 1830 1840 1850
LSLPPPPRPP APRLFPQPPS TSIPSTDSIS APAAKCTASA THARETTSTT
1860 1870 1880 1890 1900
QPPASNPQWG AEPHRHPKGI LRHVKNLAEL EKSVSNMYSH IEKNCPPADP
1910 1920 1930 1940
SKLHTFCPAE KTGMKITHDQ SQETLVRVVE GIDVQPHSQS TSL
Length:1,943
Mass (Da):214,738
Last modified:June 26, 2013 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i6FD6836082655855
GO
Isoform 2 (identifier: Q99PJ1-2) [UniParc]FASTAAdd to basket
Also known as: CD1-2

The sequence of this isoform differs from the canonical sequence as follows:
     31-35: Missing.

Show »
Length:1,938
Mass (Da):214,016
Checksum:i40B0EB13DF4E5EFC
GO
Isoform 3 (identifier: Q99PJ1-3) [UniParc]FASTAAdd to basket
Also known as: CD1-3/5

The sequence of this isoform differs from the canonical sequence as follows:
     31-35: Missing.
     645-689: ATDREGDPIT...ALDRESTDRY → HRDSQPREGS...HCEHSGDGRQ
     690-1943: Missing.

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.Curated
Show »
Length:684
Mass (Da):76,656
Checksum:i9042A0B5CB766F1F
GO
Isoform 4 (identifier: Q99PJ1-4) [UniParc]FASTAAdd to basket
Also known as: CD1-4

The sequence of this isoform differs from the canonical sequence as follows:
     31-35: Missing.
     1461-1463: MHN → I

Show »
Length:1,936
Mass (Da):213,747
Checksum:i3740C7F23545D42B
GO
Isoform 5 (identifier: Q99PJ1-5) [UniParc]FASTAAdd to basket
Also known as: CD1-6

The sequence of this isoform differs from the canonical sequence as follows:
     31-35: Missing.
     600-671: RHSICTVYIEVLPPNNQSPPRFPQLMYSLEVSEAMRIGAILLNLQATDREGDPITYAIENGDPQRVFNLSET → S

Show »
Length:1,867
Mass (Da):205,990
Checksum:iEC9AFA9363BE7757
GO
Isoform 6 (identifier: Q99PJ1-6) [UniParc]FASTAAdd to basket
Also known as: CD1-7

The sequence of this isoform differs from the canonical sequence as follows:
     31-35: Missing.
     1407-1409: Missing.
     1461-1463: MHN → I

Show »
Length:1,933
Mass (Da):213,372
Checksum:iC708CC475A755E15
GO
Isoform 7 (identifier: Q99PJ1-7) [UniParc]FASTAAdd to basket
Also known as: CD1-8

The sequence of this isoform differs from the canonical sequence as follows:
     31-35: Missing.
     204-240: Missing.
     1407-1409: Missing.
     1461-1463: MHN → I

Show »
Length:1,896
Mass (Da):209,000
Checksum:iCAA46E2AA740CA6A
GO
Isoform 8 (identifier: Q99PJ1-8) [UniParc]FASTAAdd to basket
Also known as: CD1-9

The sequence of this isoform differs from the canonical sequence as follows:
     31-57: Missing.

Show »
Length:1,916
Mass (Da):211,721
Checksum:iA416619EE89EABC8
GO
Isoform 9 (identifier: Q99PJ1-9) [UniParc]FASTAAdd to basket
Also known as: CD1-10

The sequence of this isoform differs from the canonical sequence as follows:
     31-57: Missing.
     1407-1409: Missing.

Show »
Length:1,913
Mass (Da):211,347
Checksum:iFB42EBAEE0565806
GO
Isoform 10 (identifier: Q99PJ1-10) [UniParc]FASTAAdd to basket
Also known as: CD2-1

The sequence of this isoform differs from the canonical sequence as follows:
     440-440: D → DVPPGGVP
     1463-1943: NLFLLYHFEQ...VQPHSQSTSL → KYEMPQYGSR...ANSEGYNTAL

Show »
Length:1,790
Mass (Da):198,941
Checksum:i5731151E416F5119
GO
Isoform 11 (identifier: Q99PJ1-11) [UniParc]FASTAAdd to basket
Also known as: CD2-2

The sequence of this isoform differs from the canonical sequence as follows:
     31-35: Missing.
     1463-1523: NLFLLYHFEQ...PNPARTFSFV → KSYPWNLGLI...KLKRNMKKKR
     1524-1943: Missing.

Show »
Length:1,518
Mass (Da):168,209
Checksum:i31FC7C15E9D26B80
GO
Isoform 12 (identifier: Q99PJ1-12) [UniParc]FASTAAdd to basket
Also known as: CD2-3

The sequence of this isoform differs from the canonical sequence as follows:
     1-401: Missing.
     440-440: D → DVPPGGVP
     1463-1523: NLFLLYHFEQ...PNPARTFSFV → KSYPWNLGLI...KLKRNMKKKR
     1524-1943: Missing.

Show »
Length:1,129
Mass (Da):124,249
Checksum:i1B8BAD179452BA79
GO
Isoform 13 (identifier: Q99PJ1-13) [UniParc]FASTAAdd to basket
Also known as: CD2-4

The sequence of this isoform differs from the canonical sequence as follows:
     31-35: Missing.
     298-331: EELNPILVTPPIQAIDQDRNIQPPSDRPGILYSI → DFGSLRSGANSWCQGCGGVHRCPSPWRRLLPRRL
     332-1943: Missing.

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.Curated
Show »
Length:326
Mass (Da):36,453
Checksum:iFA6863C72C1324C2
GO
Isoform 14 (identifier: Q99PJ1-14) [UniParc]FASTAAdd to basket
Also known as: CD2-5

The sequence of this isoform differs from the canonical sequence as follows:
     31-35: Missing.
     335-339: TPEDY → RARES
     340-1943: Missing.

Show »
Length:334
Mass (Da):37,309
Checksum:i8A4A6FECF06B3883
GO
Isoform 15 (identifier: Q99PJ1-15) [UniParc]FASTAAdd to basket
Also known as: CD2-6

The sequence of this isoform differs from the canonical sequence as follows:
     31-35: Missing.
     372-655: AEQDNGHPLP...TDREGDPITY → VEPEKVKKPK...ANSEGYNTAL
     656-1943: Missing.

Show »
Length:650
Mass (Da):73,340
Checksum:i0E288A38E5D417FF
GO
Isoform 16 (identifier: Q99PJ1-16) [UniParc]FASTAAdd to basket
Also known as: CD2-7

The sequence of this isoform differs from the canonical sequence as follows:
     31-35: Missing.
     441-725: TKDPELHLFL...NDNAPVFDPY → VEPEKVKKPK...ANSEGYNTAL
     726-1943: Missing.

Show »
Length:719
Mass (Da):80,894
Checksum:iFFC3D62480CD3DED
GO
Isoform 17 (identifier: Q99PJ1-17) [UniParc]FASTAAdd to basket
Also known as: CD2-8

The sequence of this isoform differs from the canonical sequence as follows:
     31-35: Missing.
     703-986: TSTATVNIVV...FPYPASIFDV → VEPEKVKKPK...ANSEGYNTAL
     987-1943: Missing.

Show »
Length:981
Mass (Da):109,606
Checksum:i56619B194F1C4501
GO
Isoform 18 (identifier: Q99PJ1-18) [UniParc]FASTAAdd to basket
Also known as: CD3-1

The sequence of this isoform differs from the canonical sequence as follows:
     1463-1682: NLFLLYHFEQ...SHFSFSTLPT → KYEMPQYGSR...NSLHIPMTKL
     1683-1943: Missing.

Show »
Length:1,682
Mass (Da):186,541
Checksum:i820F564D0CF70A21
GO
Isoform 19 (identifier: Q99PJ1-19) [UniParc]FASTAAdd to basket
Also known as: CD3-2

The sequence of this isoform differs from the canonical sequence as follows:
     31-35: Missing.
     1463-1682: NLFLLYHFEQ...SHFSFSTLPT → KYEMPQYGSR...NSLHIPMTKL
     1683-1943: Missing.

Show »
Length:1,677
Mass (Da):185,819
Checksum:i2823260AD289185F
GO
Isoform 20 (identifier: Q99PJ1-20) [UniParc]FASTAAdd to basket
Also known as: CD3-3

The sequence of this isoform differs from the canonical sequence as follows:
     1-1252: Missing.
     1407-1667: FKVRQAECTK...QLKSLSSGSS → GGFAPEHQLL...NSLHIPMTKL
     1668-1943: Missing.

Show »
Length:415
Mass (Da):46,543
Checksum:i58702C92B3B8A8B1
GO
Isoform 21 (identifier: Q99PJ1-21) [UniParc]FASTAAdd to basket
Also known as: SI-1

The sequence of this isoform differs from the canonical sequence as follows:
     1131-1176: NTAKVYIEIQ...SVLRVKATDR → LSVIPCSWRT...STRAASVPIH
     1177-1943: Missing.

Show »
Length:1,176
Mass (Da):129,853
Checksum:i694D3FBB2455620D
GO
Isoform 22 (identifier: Q99PJ1-22) [UniParc]FASTAAdd to basket
Also known as: SI-2

The sequence of this isoform differs from the canonical sequence as follows:
     31-35: Missing.
     1131-1176: NTAKVYIEIQ...SVLRVKATDR → LSVIPCSWRT...STRAASVPIH
     1177-1943: Missing.

Show »
Length:1,171
Mass (Da):129,132
Checksum:iF1F9A2CAA115DEA2
GO
Isoform 23 (identifier: Q99PJ1-23) [UniParc]FASTAAdd to basket
Also known as: SI-3

The sequence of this isoform differs from the canonical sequence as follows:
     31-35: Missing.
     441-961: Missing.
     1131-1176: NTAKVYIEIQ...SVLRVKATDR → LSVIPCSWRT...STRAASVPIH
     1177-1943: Missing.

Show »
Length:650
Mass (Da):72,054
Checksum:iE3300DA7C9F333FB
GO
Isoform 24 (identifier: Q99PJ1-24) [UniParc]FASTAAdd to basket
Also known as: C

The sequence of this isoform differs from the canonical sequence as follows:
     31-600: Missing.
     1464-1473: Missing.

Note: Produced by aberrant splicing sites.Curated
Show »
Length:1,363
Mass (Da):149,922
Checksum:i5047B631063401AD
GO
Isoform 25 (identifier: Q99PJ1-25) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1462-1943: HNLFLLYHFE...VQPHSQSTSL → YEMPQYGSRR...ANSEGYNTAL

Show »
Length:1,781
Mass (Da):198,072
Checksum:iEE3878002ED66B31
GO
Isoform 26 (identifier: Q99PJ1-26) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1407-1409: Missing.
     1462-1943: HNLFLLYHFE...VQPHSQSTSL → YEMPQYGSRR...NSLHIPMTKL

Show »
Length:1,677
Mass (Da):185,901
Checksum:i924FA442271BE3F4
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 5 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A0A6YY17A0A0A6YY17_MOUSE
Protocadherin-15
Pcdh15
1,783Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0A6YXB5A0A0A6YXB5_MOUSE
Protocadherin-15
Pcdh15
1,714Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9Q159E9Q159_MOUSE
Protocadherin-15
Pcdh15
1,865Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A140T8S2A0A140T8S2_MOUSE
Protocadherin-15
Pcdh15
1,675Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0A6YWL3A0A0A6YWL3_MOUSE
Protocadherin-15
Pcdh15
1,333Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence ABC79270 differs from that shown. Reason: Erroneous initiation. Extended N-terminus.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti608I → T in AAG53891 (PubMed:11138007).Curated1
Sequence conflicti608I → T in AAY24693 (PubMed:16799054).Curated1
Sequence conflicti608I → T in ABC79259 (PubMed:16807332).Curated1
Sequence conflicti608I → T in ABC79260 (PubMed:16807332).Curated1
Sequence conflicti608I → T in ABC79261 (PubMed:16807332).Curated1
Sequence conflicti608I → T in ABC79262 (PubMed:16807332).Curated1
Sequence conflicti608I → T in ABC79264 (PubMed:16807332).Curated1
Sequence conflicti608I → T in ABC79265 (PubMed:16807332).Curated1
Sequence conflicti608I → T in ABC79266 (PubMed:16807332).Curated1
Sequence conflicti608I → T in ABC79267 (PubMed:16807332).Curated1
Sequence conflicti608I → T in ABC79268 (PubMed:16807332).Curated1
Sequence conflicti608I → T in ABC79269 (PubMed:16807332).Curated1
Sequence conflicti608I → T in ABC79270 (PubMed:16807332).Curated1
Sequence conflicti608I → T in ABC79276 (PubMed:16807332).Curated1
Sequence conflicti608I → T in ABC79277 (PubMed:16807332).Curated1
Sequence conflicti901V → A in AAG53891 (PubMed:11138007).Curated1
Sequence conflicti901V → A in AAY24693 (PubMed:16799054).Curated1
Sequence conflicti901V → A in ABC79259 (PubMed:16807332).Curated1
Sequence conflicti901V → A in ABC79261 (PubMed:16807332).Curated1
Sequence conflicti901V → A in ABC79263 (PubMed:16807332).Curated1
Sequence conflicti901V → A in ABC79264 (PubMed:16807332).Curated1
Sequence conflicti901V → A in ABC79265 (PubMed:16807332).Curated1
Sequence conflicti901V → A in ABC79266 (PubMed:16807332).Curated1
Sequence conflicti901V → A in ABC79267 (PubMed:16807332).Curated1
Sequence conflicti901V → A in ABC79268 (PubMed:16807332).Curated1
Sequence conflicti901V → A in ABC79269 (PubMed:16807332).Curated1
Sequence conflicti901V → A in ABC79270 (PubMed:16807332).Curated1
Sequence conflicti901V → A in ABC79276 (PubMed:16807332).Curated1
Sequence conflicti901V → A in ABC79277 (PubMed:16807332).Curated1
Sequence conflicti1748S → F in AAG53891 (PubMed:11138007).Curated1
Sequence conflicti1748S → F in AAY24693 (PubMed:16799054).Curated1
Sequence conflicti1748S → F in ABC79259 (PubMed:16807332).Curated1
Sequence conflicti1748S → F in ABC79261 (PubMed:16807332).Curated1
Sequence conflicti1748S → F in ABC79263 (PubMed:16807332).Curated1
Sequence conflicti1748S → F in ABC79264 (PubMed:16807332).Curated1
Sequence conflicti1748S → F in ABC79265 (PubMed:16807332).Curated1
Sequence conflicti1748S → F in ABC79266 (PubMed:16807332).Curated1
Sequence conflicti1748S → F in ABC79267 (PubMed:16807332).Curated1
Sequence conflicti1848S → F in AAG53891 (PubMed:11138007).Curated1
Sequence conflicti1848S → F in AAY24693 (PubMed:16799054).Curated1
Sequence conflicti1848S → F in ABC79259 (PubMed:16807332).Curated1
Sequence conflicti1848S → F in ABC79261 (PubMed:16807332).Curated1
Sequence conflicti1848S → F in ABC79263 (PubMed:16807332).Curated1
Sequence conflicti1848S → F in ABC79264 (PubMed:16807332).Curated1
Sequence conflicti1848S → F in ABC79265 (PubMed:16807332).Curated1
Sequence conflicti1848S → F in ABC79266 (PubMed:16807332).Curated1
Sequence conflicti1848S → F in ABC79267 (PubMed:16807332).Curated1
Sequence conflicti1859W → G in BAE24546 (PubMed:16141072).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0465761 – 1252Missing in isoform 20. 1 PublicationAdd BLAST1252
Alternative sequenceiVSP_0465771 – 401Missing in isoform 12. 1 PublicationAdd BLAST401
Alternative sequenceiVSP_04657831 – 600Missing in isoform 24. 1 PublicationAdd BLAST570
Alternative sequenceiVSP_04657931 – 57Missing in isoform 8 and isoform 9. 1 PublicationAdd BLAST27
Alternative sequenceiVSP_04658031 – 35Missing in isoform 2, isoform 3, isoform 4, isoform 5, isoform 6, isoform 7, isoform 11, isoform 13, isoform 14, isoform 15, isoform 16, isoform 17, isoform 19, isoform 22 and isoform 23. 1 Publication5
Alternative sequenceiVSP_046581204 – 240Missing in isoform 7. 1 PublicationAdd BLAST37
Alternative sequenceiVSP_046582298 – 331EELNP…ILYSI → DFGSLRSGANSWCQGCGGVH RCPSPWRRLLPRRL in isoform 13. 1 PublicationAdd BLAST34
Alternative sequenceiVSP_046583332 – 1943Missing in isoform 13. 1 PublicationAdd BLAST1612
Alternative sequenceiVSP_046584335 – 339TPEDY → RARES in isoform 14. 1 Publication5
Alternative sequenceiVSP_046585340 – 1943Missing in isoform 14. 1 PublicationAdd BLAST1604
Alternative sequenceiVSP_046587372 – 655AEQDN…DPITY → VEPEKVKKPKVEIREPSEEE VVVTVEKPPAAEPTYPTWKR ARIFPMIFKKVRGLAEKRGI DLEGEEWRRRLDEEDKDYLQ LTLDQEEATESTVESEEESS DYTEYTETESEFSESETTEE SESETPSEEAEESSTPESEE SESTESEGEKARKNIVLARR RPVVEEIQEVKGKREEPPVE EEEEPPLEEEERAEEGEESE AAPMDESTDLEAQDVPEEGS AESVSMERGVESEESESELS SSSSTSESLSGGPWGFQVPE YDRRKDEEPKKSPGANSEGY NTAL in isoform 15. 1 PublicationAdd BLAST284
Alternative sequenceiVSP_046588440D → DVPPGGVP in isoform 10 and isoform 12. 1 Publication1
Alternative sequenceiVSP_046589441 – 961Missing in isoform 23. 1 PublicationAdd BLAST521
Alternative sequenceiVSP_046590441 – 725TKDPE…VFDPY → VEPEKVKKPKVEIREPSEEE VVVTVEKPPAAEPTYPTWKR ARIFPMIFKKVRGLAEKRGI DLEGEEWRRRLDEEDKDYLQ LTLDQEEATESTVESEEESS DYTEYTETESEFSESETTEE SESETPSEEAEESSTPESEE SESTESEGEKARKNIVLARR RPVVEEIQEVKGKREEPPVE EEEEPPLEEEERAEEGEESE AAPMDESTDLEAQDVPEEGS AESVSMERGVESEESESELS SSSSTSESLSGGPWGFQVPE YDRRKDEEPKKSPGANSEGY NTAL in isoform 16. 1 PublicationAdd BLAST285
Alternative sequenceiVSP_046591600 – 671RHSIC…NLSET → S in isoform 5. 1 PublicationAdd BLAST72
Alternative sequenceiVSP_046592645 – 689ATDRE…STDRY → HRDSQPREGSRPREHRPLHP HRHSLRWQTGWNLNCHCEHS GDGRQ in isoform 3. 1 PublicationAdd BLAST45
Alternative sequenceiVSP_046593656 – 1943Missing in isoform 15. 1 PublicationAdd BLAST1288
Alternative sequenceiVSP_046594690 – 1943Missing in isoform 3. 1 PublicationAdd BLAST1254
Alternative sequenceiVSP_046595703 – 986TSTAT…SIFDV → VEPEKVKKPKVEIREPSEEE VVVTVEKPPAAEPTYPTWKR ARIFPMIFKKVRGLAEKRGI DLEGEEWRRRLDEEDKDYLQ LTLDQEEATESTVESEEESS DYTEYTETESEFSESETTEE SESETPSEEAEESSTPESEE SESTESEGEKARKNIVLARR RPVVEEIQEVKGKREEPPVE EEEEPPLEEEERAEEGEESE AAPMDESTDLEAQDVPEEGS AESVSMERGVESEESESELS SSSSTSESLSGGPWGFQVPE YDRRKDEEPKKSPGANSEGY NTAL in isoform 17. 1 PublicationAdd BLAST284
Alternative sequenceiVSP_046596726 – 1943Missing in isoform 16. 1 PublicationAdd BLAST1218
Alternative sequenceiVSP_046597987 – 1943Missing in isoform 17. 1 PublicationAdd BLAST957
Alternative sequenceiVSP_0465981131 – 1176NTAKV…KATDR → LSVIPCSWRTQVSKSLGLEL GVPVSHSVESGTRTGSSTRA ASVPIH in isoform 21, isoform 22 and isoform 23. 2 PublicationsAdd BLAST46
Alternative sequenceiVSP_0465991177 – 1943Missing in isoform 21, isoform 22 and isoform 23. 2 PublicationsAdd BLAST767
Alternative sequenceiVSP_0466001407 – 1667FKVRQ…SSGSS → GGFAPEHQLLRPSLLKPEEL SMESGIDPGQEYGQDYYSYE HGYEMPQYGSRRRLLPPAGQ EEYGEVIGEAEEEYEEEEWA RKRMIKLVVDREYESSSPGE DSAPESQRSRTHKPSGRSNV NGNIYIAQNGSVVRTRRACV ADNLKVPSPGLLGRHLKKLD TLAGTREENVPLNTLFKGPF STEKAKRTPTLVTFAPCPVV AEHSAVKPSGTRLKHTAEQE SMVDSRLSRESMEFHGDSAP SDEEELWMGPWNSLHIPMTK L in isoform 20. 1 PublicationAdd BLAST261
Alternative sequenceiVSP_0466011407 – 1409Missing in isoform 6, isoform 7, isoform 9 and isoform 26. 2 Publications3
Alternative sequenceiVSP_0466021461 – 1463MHN → I in isoform 4, isoform 6 and isoform 7. 1 Publication3
Alternative sequenceiVSP_0466031462 – 1943HNLFL…QSTSL → YEMPQYGSRRRLLPPAGQEE YGEVIGEAEEEYEEEEVEPE KVKKPKVEIREPSEEEVVVT VEKPPAAEPTYPTWKRARIF PMIFKKVRGLAEKRGIDLEG EEWRRRLDEEDKDYLQLTLD QEEATESTVESEEESSDYTE YTETESEFSESETTEESESE TPSEEAEESSTPESEESEST ESEGEKARKNIVLARRRPVV EEIQEVKGKREEPPVEEEEE PPLEEEERAEEGEESEAAPM DESTDLEAQDVPEEGSAESV SMERGVESEESESELSSSSS TSESLSGGPWGFQVPEYDRR KDEEPKKSPGANSEGYNTAL in isoform 25. 1 PublicationAdd BLAST482
Alternative sequenceiVSP_0466041462 – 1943HNLFL…QSTSL → YEMPQYGSRRRLLPPAGQEE YGEVIGEAEEEYEEEEWARK RMIKLVVDREYESSSPGEDS APESQRSRTHKPSGRSNVNG NIYIAQNGSVVRTRRACVAD NLKVPSPGLLGRHLKKLDTL AGTREENVPLNTLFKGPFST EKAKRTPTLVTFAPCPVVAE HSAVKPSGTRLKHTAEQESM VDSRLSRESMEFHGDSAPSD EEELWMGPWNSLHIPMTKL in isoform 26. 1 PublicationAdd BLAST482
Alternative sequenceiVSP_0466051463 – 1943NLFLL…QSTSL → KYEMPQYGSRRRLLPPAGQE EYGEVIGEAEEEYEEEEVEP EKVKKPKVEIREPSEEEVVV TVEKPPAAEPTYPTWKRARI FPMIFKKVRGLAEKRGIDLE GEEWRRRLDEEDKDYLQLTL DQEEATESTVESEEESSDYT EYTETESEFSESETTEESES ETPSEEAEESSTPESEESES TESEGEKARKNIVLARRRPV VEEIQEVKGKREEPPVEEEE EPPLEEEERAEEGEESEAAP MDESTDLEAQDVPEEGSAES VSMERGVESEESESELSSSS STSESLSGGPWGFQVPEYDR RKDEEPKKSPGANSEGYNTA L in isoform 10. 1 PublicationAdd BLAST481
Alternative sequenceiVSP_0466061463 – 1682NLFLL…STLPT → KYEMPQYGSRRRLLPPAGQE EYGEVIGEAEEEYEEEEWAR KRMIKLVVDREYESSSPGED SAPESQRSRTHKPSGRSNVN GNIYIAQNGSVVRTRRACVA DNLKVPSPGLLGRHLKKLDT LAGTREENVPLNTLFKGPFS TEKAKRTPTLVTFAPCPVVA EHSAVKPSGTRLKHTAEQES MVDSRLSRESMEFHGDSAPS DEEELWMGPWNSLHIPMTKL in isoform 18 and isoform 19. 1 PublicationAdd BLAST220
Alternative sequenceiVSP_0466071463 – 1523NLFLL…TFSFV → KSYPWNLGLILARNMDKIIT VMSMGMRCPSMEVAVDCCHL LDRRNTAKSLVKLKRNMKKK R in isoform 11 and isoform 12. 1 PublicationAdd BLAST61
Alternative sequenceiVSP_0466081464 – 1473Missing in isoform 24. 1 Publication10
Alternative sequenceiVSP_0466091524 – 1943Missing in isoform 11 and isoform 12. 1 PublicationAdd BLAST420
Alternative sequenceiVSP_0466101668 – 1943Missing in isoform 20. 1 PublicationAdd BLAST276
Alternative sequenceiVSP_0466111683 – 1943Missing in isoform 18 and isoform 19. 1 PublicationAdd BLAST261

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF281899 mRNA Translation: AAG53891.1
AY949849 mRNA Translation: AAY24693.1
DQ354396 mRNA Translation: ABC79259.1
DQ354397 mRNA Translation: ABC79260.1
DQ354398 mRNA Translation: ABC79261.1
DQ354399 mRNA Translation: ABC79262.1
DQ354400 mRNA Translation: ABC79263.1
DQ354401 mRNA Translation: ABC79264.1
DQ354402 mRNA Translation: ABC79265.1
DQ354403 mRNA Translation: ABC79266.1
DQ354404 mRNA Translation: ABC79267.1
DQ354405 mRNA Translation: ABC79268.1
DQ354406 mRNA Translation: ABC79269.1
DQ354407 mRNA Translation: ABC79270.1 Different initiation.
DQ354408 mRNA Translation: ABC79271.1
DQ354409 mRNA Translation: ABC79272.1
DQ354410 mRNA Translation: ABC79273.1
DQ354411 mRNA Translation: ABC79274.1
DQ354412 mRNA Translation: ABC79275.1
DQ354413 mRNA Translation: ABC79276.1
DQ354414 mRNA Translation: ABC79277.1
DQ354415 mRNA Translation: ABC79278.1
DQ354416 mRNA Translation: ABC79279.1
DQ354417 mRNA Translation: ABC79280.1
DQ354418 mRNA Translation: ABC79281.1
AK139154 mRNA Translation: BAE23903.1
AK141024 mRNA Translation: BAE24546.1
AC108392 Genomic DNA No translation available.
AC119894 Genomic DNA No translation available.
AC121142 Genomic DNA No translation available.
AC121602 Genomic DNA No translation available.
AC121832 Genomic DNA No translation available.
AC123032 Genomic DNA No translation available.
AC123809 Genomic DNA No translation available.
AC144802 Genomic DNA No translation available.
AC147721 Genomic DNA No translation available.
AC153858 Genomic DNA No translation available.
AC158800 Genomic DNA No translation available.
AC159477 Genomic DNA No translation available.
AC186813 Genomic DNA No translation available.
AC188091 Genomic DNA No translation available.
CAAA01110489 Genomic DNA No translation available.
HQ404375 mRNA Translation: ADP09331.1
HQ420254 mRNA Translation: ADT91308.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS35934.1 [Q99PJ1-1]
CCDS48594.1 [Q99PJ1-6]
CCDS48595.1 [Q99PJ1-7]
CCDS56711.1 [Q99PJ1-10]
CCDS56712.1 [Q99PJ1-21]
CCDS56713.1 [Q99PJ1-18]
CCDS56714.1 [Q99PJ1-22]
CCDS56715.1 [Q99PJ1-2]
CCDS56716.1 [Q99PJ1-11]
CCDS56717.1 [Q99PJ1-19]
CCDS56718.1 [Q99PJ1-4]
CCDS56719.1 [Q99PJ1-5]
CCDS56720.1 [Q99PJ1-8]
CCDS56721.1 [Q99PJ1-9]

NCBI Reference Sequences

More...
RefSeqi
NP_001136207.1, NM_001142735.1 [Q99PJ1-2]
NP_001136208.1, NM_001142736.1 [Q99PJ1-4]
NP_001136209.1, NM_001142737.1 [Q99PJ1-5]
NP_001136210.1, NM_001142738.1 [Q99PJ1-7]
NP_001136211.1, NM_001142739.1 [Q99PJ1-8]
NP_001136212.1, NM_001142740.1 [Q99PJ1-6]
NP_001136213.1, NM_001142741.1 [Q99PJ1-9]
NP_001136214.1, NM_001142742.1 [Q99PJ1-10]
NP_001136215.1, NM_001142743.1 [Q99PJ1-11]
NP_001136218.1, NM_001142746.1 [Q99PJ1-18]
NP_001136219.1, NM_001142747.1 [Q99PJ1-21]
NP_001136220.1, NM_001142748.1 [Q99PJ1-22]
NP_001136232.1, NM_001142760.1 [Q99PJ1-19]
NP_075604.2, NM_023115.3 [Q99PJ1-1]
XP_006513219.1, XM_006513156.3 [Q99PJ1-26]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSMUST00000092420; ENSMUSP00000090076; ENSMUSG00000052613 [Q99PJ1-6]
ENSMUST00000105424; ENSMUSP00000101064; ENSMUSG00000052613 [Q99PJ1-2]
ENSMUST00000105426; ENSMUSP00000101066; ENSMUSG00000052613 [Q99PJ1-4]
ENSMUST00000105429; ENSMUSP00000101069; ENSMUSG00000052613 [Q99PJ1-5]
ENSMUST00000124046; ENSMUSP00000121130; ENSMUSG00000052613 [Q99PJ1-12]
ENSMUST00000125006; ENSMUSP00000120056; ENSMUSG00000052613 [Q99PJ1-22]
ENSMUST00000125055; ENSMUSP00000114326; ENSMUSG00000052613 [Q99PJ1-3]
ENSMUST00000125517; ENSMUSP00000115399; ENSMUSG00000052613 [Q99PJ1-16]
ENSMUST00000126920; ENSMUSP00000121939; ENSMUSG00000052613 [Q99PJ1-8]
ENSMUST00000129404; ENSMUSP00000117731; ENSMUSG00000052613 [Q99PJ1-9]
ENSMUST00000131321; ENSMUSP00000122911; ENSMUSG00000052613 [Q99PJ1-4]
ENSMUST00000131724; ENSMUSP00000122466; ENSMUSG00000052613 [Q99PJ1-11]
ENSMUST00000134009; ENSMUSP00000120618; ENSMUSG00000052613 [Q99PJ1-23]
ENSMUST00000136096; ENSMUSP00000121534; ENSMUSG00000052613 [Q99PJ1-3]
ENSMUST00000144302; ENSMUSP00000122606; ENSMUSG00000052613 [Q99PJ1-13]
ENSMUST00000146682; ENSMUSP00000134863; ENSMUSG00000052613 [Q99PJ1-20]
ENSMUST00000147189; ENSMUSP00000122940; ENSMUSG00000052613 [Q99PJ1-7]
ENSMUST00000151116; ENSMUSP00000119662; ENSMUSG00000052613 [Q99PJ1-10]
ENSMUST00000152655; ENSMUSP00000118201; ENSMUSG00000052613 [Q99PJ1-17]
ENSMUST00000152819; ENSMUSP00000123647; ENSMUSG00000052613 [Q99PJ1-15]
ENSMUST00000155701; ENSMUSP00000135495; ENSMUSG00000052613 [Q99PJ1-14]
ENSMUST00000177107; ENSMUSP00000135501; ENSMUSG00000052613 [Q99PJ1-18]
ENSMUST00000177420; ENSMUSP00000135849; ENSMUSG00000052613 [Q99PJ1-21]
ENSMUST00000191709; ENSMUSP00000142313; ENSMUSG00000052613 [Q99PJ1-25]
ENSMUST00000191854; ENSMUSP00000141973; ENSMUSG00000052613 [Q99PJ1-19]
ENSMUST00000193361; ENSMUSP00000141792; ENSMUSG00000052613 [Q99PJ1-1]
ENSMUST00000193739; ENSMUSP00000142173; ENSMUSG00000052613 [Q99PJ1-26]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
11994

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
mmu:11994

UCSC genome browser

More...
UCSCi
uc007fpf.2, mouse [Q99PJ1-21]
uc007fpg.2, mouse [Q99PJ1-22]
uc007fph.2, mouse [Q99PJ1-10]
uc007fpi.2, mouse [Q99PJ1-8]
uc007fpj.2, mouse [Q99PJ1-9]
uc007fpk.2, mouse [Q99PJ1-1]
uc007fpl.2, mouse [Q99PJ1-4]
uc007fpn.2, mouse [Q99PJ1-6]
uc007fpo.2, mouse [Q99PJ1-17]
uc007fpq.2, mouse [Q99PJ1-20]
uc007fpr.2, mouse [Q99PJ1-11]
uc011xfz.1, mouse [Q99PJ1-23]
uc011xgb.1, mouse [Q99PJ1-7]
uc011xgc.1, mouse [Q99PJ1-5]
uc011xgd.1, mouse [Q99PJ1-15]
uc011xge.1, mouse [Q99PJ1-16]
uc011xgf.1, mouse [Q99PJ1-14]
uc011xgg.1, mouse [Q99PJ1-18]
uc011xgh.1, mouse [Q99PJ1-19]
uc033fqa.1, mouse [Q99PJ1-2]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF281899 mRNA Translation: AAG53891.1
AY949849 mRNA Translation: AAY24693.1
DQ354396 mRNA Translation: ABC79259.1
DQ354397 mRNA Translation: ABC79260.1
DQ354398 mRNA Translation: ABC79261.1
DQ354399 mRNA Translation: ABC79262.1
DQ354400 mRNA Translation: ABC79263.1
DQ354401 mRNA Translation: ABC79264.1
DQ354402 mRNA Translation: ABC79265.1
DQ354403 mRNA Translation: ABC79266.1
DQ354404 mRNA Translation: ABC79267.1
DQ354405 mRNA Translation: ABC79268.1
DQ354406 mRNA Translation: ABC79269.1
DQ354407 mRNA Translation: ABC79270.1 Different initiation.
DQ354408 mRNA Translation: ABC79271.1
DQ354409 mRNA Translation: ABC79272.1
DQ354410 mRNA Translation: ABC79273.1
DQ354411 mRNA Translation: ABC79274.1
DQ354412 mRNA Translation: ABC79275.1
DQ354413 mRNA Translation: ABC79276.1
DQ354414 mRNA Translation: ABC79277.1
DQ354415 mRNA Translation: ABC79278.1
DQ354416 mRNA Translation: ABC79279.1
DQ354417 mRNA Translation: ABC79280.1
DQ354418 mRNA Translation: ABC79281.1
AK139154 mRNA Translation: BAE23903.1
AK141024 mRNA Translation: BAE24546.1
AC108392 Genomic DNA No translation available.
AC119894 Genomic DNA No translation available.
AC121142 Genomic DNA No translation available.
AC121602 Genomic DNA No translation available.
AC121832 Genomic DNA No translation available.
AC123032 Genomic DNA No translation available.
AC123809 Genomic DNA No translation available.
AC144802 Genomic DNA No translation available.
AC147721 Genomic DNA No translation available.
AC153858 Genomic DNA No translation available.
AC158800 Genomic DNA No translation available.
AC159477 Genomic DNA No translation available.
AC186813 Genomic DNA No translation available.
AC188091 Genomic DNA No translation available.
CAAA01110489 Genomic DNA No translation available.
HQ404375 mRNA Translation: ADP09331.1
HQ420254 mRNA Translation: ADT91308.1
CCDSiCCDS35934.1 [Q99PJ1-1]
CCDS48594.1 [Q99PJ1-6]
CCDS48595.1 [Q99PJ1-7]
CCDS56711.1 [Q99PJ1-10]
CCDS56712.1 [Q99PJ1-21]
CCDS56713.1 [Q99PJ1-18]
CCDS56714.1 [Q99PJ1-22]
CCDS56715.1 [Q99PJ1-2]
CCDS56716.1 [Q99PJ1-11]
CCDS56717.1 [Q99PJ1-19]
CCDS56718.1 [Q99PJ1-4]
CCDS56719.1 [Q99PJ1-5]
CCDS56720.1 [Q99PJ1-8]
CCDS56721.1 [Q99PJ1-9]
RefSeqiNP_001136207.1, NM_001142735.1 [Q99PJ1-2]
NP_001136208.1, NM_001142736.1 [Q99PJ1-4]
NP_001136209.1, NM_001142737.1 [Q99PJ1-5]
NP_001136210.1, NM_001142738.1 [Q99PJ1-7]
NP_001136211.1, NM_001142739.1 [Q99PJ1-8]
NP_001136212.1, NM_001142740.1 [Q99PJ1-6]
NP_001136213.1, NM_001142741.1 [Q99PJ1-9]
NP_001136214.1, NM_001142742.1 [Q99PJ1-10]
NP_001136215.1, NM_001142743.1 [Q99PJ1-11]
NP_001136218.1, NM_001142746.1 [Q99PJ1-18]
NP_001136219.1, NM_001142747.1 [Q99PJ1-21]
NP_001136220.1, NM_001142748.1 [Q99PJ1-22]
NP_001136232.1, NM_001142760.1 [Q99PJ1-19]
NP_075604.2, NM_023115.3 [Q99PJ1-1]
XP_006513219.1, XM_006513156.3 [Q99PJ1-26]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
4APXX-ray1.65B27-259[»]
4AQ8X-ray2.63C/D27-259[»]
4AQAX-ray1.96B27-259[»]
4AQEX-ray2.27B27-259[»]
4AXWX-ray2.23B27-259[»]
4XXWX-ray2.26A/B36-259[»]
5KJ4X-ray3.35A/B/C/D924-1149[»]
5TPKX-ray2.00A715-923[»]
5W1DX-ray3.35A401-818[»]
6BWNX-ray2.94A615-818[»]
6C10X-ray1.40A1144-1381[»]
6C13electron microscopy11.33A/B821-1465[»]
6C14electron microscopy4.50A/C1144-1465[»]
6CV7X-ray1.69A27-395[»]
6EETX-ray3.23A924-1379[»]
6N22X-ray2.40A27-265[»]
SMRiQ99PJ1
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGRIDi198282, 3 interactors
DIPiDIP-42151N
IntActiQ99PJ1, 3 interactors
MINTiQ99PJ1
STRINGi10090.ENSMUSP00000101066

PTM databases

GlyGeniQ99PJ1, 18 sites
iPTMnetiQ99PJ1
PhosphoSitePlusiQ99PJ1

Proteomic databases

PaxDbiQ99PJ1
PRIDEiQ99PJ1
ProteomicsDBi288267 [Q99PJ1-1]
288268 [Q99PJ1-2]
288269 [Q99PJ1-3]
288270 [Q99PJ1-4]
288271 [Q99PJ1-5]
288272 [Q99PJ1-6]
288273 [Q99PJ1-7]
288274 [Q99PJ1-8]
288275 [Q99PJ1-9]
288276 [Q99PJ1-10]
288277 [Q99PJ1-11]
288278 [Q99PJ1-12]
288279 [Q99PJ1-13]
289304 [Q99PJ1-14]
289305 [Q99PJ1-15]
289306 [Q99PJ1-16]
289307 [Q99PJ1-17]
289308 [Q99PJ1-18]
289309 [Q99PJ1-19]
289310 [Q99PJ1-20]
289311 [Q99PJ1-21]
289312 [Q99PJ1-22]
289313 [Q99PJ1-23]
289314 [Q99PJ1-24]
289315 [Q99PJ1-25]
289316 [Q99PJ1-26]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
27955, 95 antibodies

The DNASU plasmid repository

More...
DNASUi
11994

Genome annotation databases

EnsembliENSMUST00000092420; ENSMUSP00000090076; ENSMUSG00000052613 [Q99PJ1-6]
ENSMUST00000105424; ENSMUSP00000101064; ENSMUSG00000052613 [Q99PJ1-2]
ENSMUST00000105426; ENSMUSP00000101066; ENSMUSG00000052613 [Q99PJ1-4]
ENSMUST00000105429; ENSMUSP00000101069; ENSMUSG00000052613 [Q99PJ1-5]
ENSMUST00000124046; ENSMUSP00000121130; ENSMUSG00000052613 [Q99PJ1-12]
ENSMUST00000125006; ENSMUSP00000120056; ENSMUSG00000052613 [Q99PJ1-22]
ENSMUST00000125055; ENSMUSP00000114326; ENSMUSG00000052613 [Q99PJ1-3]
ENSMUST00000125517; ENSMUSP00000115399; ENSMUSG00000052613 [Q99PJ1-16]
ENSMUST00000126920; ENSMUSP00000121939; ENSMUSG00000052613 [Q99PJ1-8]
ENSMUST00000129404; ENSMUSP00000117731; ENSMUSG00000052613 [Q99PJ1-9]
ENSMUST00000131321; ENSMUSP00000122911; ENSMUSG00000052613 [Q99PJ1-4]
ENSMUST00000131724; ENSMUSP00000122466; ENSMUSG00000052613 [Q99PJ1-11]
ENSMUST00000134009; ENSMUSP00000120618; ENSMUSG00000052613 [Q99PJ1-23]
ENSMUST00000136096; ENSMUSP00000121534; ENSMUSG00000052613 [Q99PJ1-3]
ENSMUST00000144302; ENSMUSP00000122606; ENSMUSG00000052613 [Q99PJ1-13]
ENSMUST00000146682; ENSMUSP00000134863; ENSMUSG00000052613 [Q99PJ1-20]
ENSMUST00000147189; ENSMUSP00000122940; ENSMUSG00000052613 [Q99PJ1-7]
ENSMUST00000151116; ENSMUSP00000119662; ENSMUSG00000052613 [Q99PJ1-10]
ENSMUST00000152655; ENSMUSP00000118201; ENSMUSG00000052613 [Q99PJ1-17]
ENSMUST00000152819; ENSMUSP00000123647; ENSMUSG00000052613 [Q99PJ1-15]
ENSMUST00000155701; ENSMUSP00000135495; ENSMUSG00000052613 [Q99PJ1-14]
ENSMUST00000177107; ENSMUSP00000135501; ENSMUSG00000052613 [Q99PJ1-18]
ENSMUST00000177420; ENSMUSP00000135849; ENSMUSG00000052613 [Q99PJ1-21]
ENSMUST00000191709; ENSMUSP00000142313; ENSMUSG00000052613 [Q99PJ1-25]
ENSMUST00000191854; ENSMUSP00000141973; ENSMUSG00000052613 [Q99PJ1-19]
ENSMUST00000193361; ENSMUSP00000141792; ENSMUSG00000052613 [Q99PJ1-1]
ENSMUST00000193739; ENSMUSP00000142173; ENSMUSG00000052613 [Q99PJ1-26]
GeneIDi11994
KEGGimmu:11994
UCSCiuc007fpf.2, mouse [Q99PJ1-21]
uc007fpg.2, mouse [Q99PJ1-22]
uc007fph.2, mouse [Q99PJ1-10]
uc007fpi.2, mouse [Q99PJ1-8]
uc007fpj.2, mouse [Q99PJ1-9]
uc007fpk.2, mouse [Q99PJ1-1]
uc007fpl.2, mouse [Q99PJ1-4]
uc007fpn.2, mouse [Q99PJ1-6]
uc007fpo.2, mouse [Q99PJ1-17]
uc007fpq.2, mouse [Q99PJ1-20]
uc007fpr.2, mouse [Q99PJ1-11]
uc011xfz.1, mouse [Q99PJ1-23]
uc011xgb.1, mouse [Q99PJ1-7]
uc011xgc.1, mouse [Q99PJ1-5]
uc011xgd.1, mouse [Q99PJ1-15]
uc011xge.1, mouse [Q99PJ1-16]
uc011xgf.1, mouse [Q99PJ1-14]
uc011xgg.1, mouse [Q99PJ1-18]
uc011xgh.1, mouse [Q99PJ1-19]
uc033fqa.1, mouse [Q99PJ1-2]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
65217
MGIiMGI:1891428, Pcdh15
VEuPathDBiHostDB:ENSMUSG00000052613

Phylogenomic databases

eggNOGiKOG3594, Eukaryota
GeneTreeiENSGT00940000156675
HOGENOMiCLU_001945_0_0_1
InParanoidiQ99PJ1
OrthoDBi21247at2759
PhylomeDBiQ99PJ1
TreeFamiTF326779

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
11994, 0 hits in 61 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
Pcdh15, mouse

Protein Ontology

More...
PROi
PR:Q99PJ1
RNActiQ99PJ1, protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSMUSG00000052613, Expressed in brain and 169 other tissues
GenevisibleiQ99PJ1, MM

Family and domain databases

InterProiView protein in InterPro
IPR002126, Cadherin-like_dom
IPR015919, Cadherin-like_sf
IPR020894, Cadherin_CS
IPR041149, EC_dom
IPR030718, Protocadherin-15
PANTHERiPTHR24028:SF11, PTHR24028:SF11, 1 hit
PfamiView protein in Pfam
PF00028, Cadherin, 8 hits
PF18432, ECD, 1 hit
PRINTSiPR00205, CADHERIN
SMARTiView protein in SMART
SM00112, CA, 11 hits
SUPFAMiSSF49313, SSF49313, 10 hits
PROSITEiView protein in PROSITE
PS00232, CADHERIN_1, 4 hits
PS50268, CADHERIN_2, 11 hits

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiPCD15_MOUSE
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q99PJ1
Secondary accession number(s): D6RCH0
, E9Q7D7, E9Q7R1, E9Q7R2, F6KJX4, F6KKG6, F6R5Z7, F6RBV2, F6U3Q6, F6UPC9, F6VPR3, F6WUN7, F6X715, F6XPA1, F6Y0A5, F6YP25, F6YZQ9, F7ASH0, F7CIN1, F7D5J8, F7DFU0, F8VQ61, H3BKS0, Q0ZM15, Q0ZM16, Q0ZM18, Q0ZM19, Q0ZM20, Q0ZM21, Q0ZM22, Q0ZM23, Q0ZM24, Q0ZM25, Q0ZM26, Q0ZM27, Q0ZM28, Q0ZM29, Q0ZM30, Q0ZM31, Q0ZM32, Q0ZM33, Q0ZM34, Q0ZM35, Q0ZM37, Q2VQG7, Q3URZ1, Q3UTS7
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: January 31, 2002
Last sequence update: June 26, 2013
Last modified: September 29, 2021
This is version 168 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Direct protein sequencing, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again