Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - Q99P30 (NUDT7_MOUSE)

Entry version 130 (10 Feb 2021)
Sequence version 2 (19 Jul 2005)
Previous versions | rss
Add a publicationFeedback
Protein

Peroxisomal coenzyme A diphosphatase NUDT7

Gene

Nudt7

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Coenzyme A diphosphatase which mediates the cleavage of CoA, CoA esters and oxidized CoA with similar efficiencies, yielding 3',5'-ADP and the corresponding 4'-phosphopantetheine derivative as products. Preferentially hydrolyzes medium-chain acyl-CoAs and bile acid-CoAs (PubMed:18799520). CoA into 3',5'-ADP and 4'-phosphopantetheine. Has no activity toward NDP-sugars, CDP-alcohols, (deoxy)nucleoside 5'-triphosphates, nucleoside 5'-di or monophosphates, diadenosine polyphosphates, NAD, NADH, NADP, NADPH or thymidine-5'-monophospho-p-nitrophenyl ester. May be required to eliminate oxidized CoA from peroxisomes, or regulate CoA and acyl-CoA levels in this organelle in response to metabolic demand. Does not play a role in U8 snoRNA decapping activity. Binds U8 snoRNA.2 Publications

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

<p>This subsection of the 'Function' section provides information relevant to cofactors. A cofactor is any non-protein substance required for a protein to be catalytically active. Some cofactors are inorganic, such as the metal atoms zinc, iron, and copper in various oxidation states. Others, such as most vitamins, are organic.<p><a href='/help/cofactor' target='_top'>More...</a></p>Cofactori

Mn2+1 Publication, Mg2+1 Publication

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes regulatory mechanisms for enzymes, transporters or microbial transcription factors, and reports the components which regulate (by activation or inhibition) the reaction.<p><a href='/help/activity_regulation' target='_top'>More...</a></p>Activity regulationi

Inhibited by fluoride.

<p>This subsection of the 'Function' section describes biophysical and chemical properties, such as maximal absorption, kinetic parameters, pH dependence, redox potentials and temperature dependence.<p><a href='/help/biophysicochemical_properties' target='_top'>More...</a></p>Kineticsi

  1. KM=0.240 mM for CoA1 Publication
  2. KM=0.157 mM for CoA1 Publication
  3. KM=0.270 mM for acetyl-CoA1 Publication
  4. KM=92.6 µM for hexanoyl-CoA1 Publication
  5. KM=62.6 µM for octanoyl-CoA1 Publication
  6. KM=34 µM for tetradecanoyl-CoA1 Publication
  7. KM=157.9 µM for butanoyl-CoA1 Publication
  8. KM=242 µM for decanoyl-CoA1 Publication
  9. KM=22.4 µM for dodecanoyl-CoA1 Publication
  10. KM=221.4 µM for propionyl-CoA1 Publication
  11. KM=28.7 µM for palmitoyl-CoA1 Publication
  12. KM=0.430 mM for acetyl-CoA1 Publication
  13. KM=0.235 mM for CoA-S-S-CoA1 Publication
  14. KM=0.330 mM for succinyl-CoA1 Publication
  15. KM=0.480 mM for 3'-dephospho-CoA1 Publication
  1. Vmax=0.13 µmol/min/mg enzyme toward CoA1 Publication
  2. Vmax=0.27 µmol/min/mg enzyme toward acetyl-CoA1 Publication
  3. Vmax=0.33 µmol/min/mg enzyme toward propionyl-CoA1 Publication
  4. Vmax=0.49 µmol/min/mg enzyme toward butanoyl-CoA1 Publication
  5. Vmax=0.83 µmol/min/mg enzyme toward hexanoyl-CoA1 Publication
  6. Vmax=1.08 µmol/min/mg enzyme toward octanoyl-CoA1 Publication
  7. Vmax=1.84 µmol/min/mg enzyme toward decanoyl-CoA1 Publication
  8. Vmax=1.06 µmol/min/mg enzyme toward dodecanoyl-CoA1 Publication
  9. Vmax=0.41 µmol/min/mg enzyme toward tetradecanoyl-CoA1 Publication
  10. Vmax=0.15 µmol/min/mg enzyme toward palmitoyl-CoA1 Publication

pH dependencei

Optimum pH is 8.1 Publication

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section indicates at which position the protein binds a given metal ion. The nature of the metal is indicated in the 'Description' field.<p><a href='/help/metal' target='_top'>More...</a></p>Metal bindingi92Magnesium or manganeseBy similarity1
Metal bindingi96Magnesium or manganeseBy similarity1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionHydrolase, RNA-binding
LigandMagnesium, Manganese, Metal-binding

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-MMU-9033241, Peroxisomal protein import

Chemistry databases

SwissLipids knowledge resource for lipid biology

More...SwissLipidsi		SLP:000001595 [Q99P30-1]

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Peroxisomal coenzyme A diphosphatase NUDT7 (EC:3.6.1.-)
Alternative name(s):
Nucleoside diphosphate-linked moiety X motif 7
Short name:
Nudix motif 7
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Nudt7Imported
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Myomorpha › Muroidea › Muridae › Murinae › Mus › Mus
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 8

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...MGIi		MGI:1914778, Nudt7

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Peroxisome

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000571411 – 236Peroxisomal coenzyme A diphosphatase NUDT7Add BLAST236

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei20N6-succinyllysineCombined sources1
Modified residuei178N6-succinyllysineCombined sources1

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		Q99P30

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q99P30

PeptideAtlas

More...PeptideAtlasi		Q99P30

PRoteomics IDEntifications database

More...PRIDEi		Q99P30

2D gel databases

REPRODUCTION-2DPAGE

More...REPRODUCTION-2DPAGEi		Q99P30

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q99P30

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q99P30

SwissPalm database of S-palmitoylation events

More...SwissPalmi		Q99P30

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Highly expressed in liver, brown adipose tissue and heart. Expressed at intermediate level in lung and kidney and at low level in brain.2 Publications
Expressed in liver, brown adipose tissue and heart at 20 times lower levels than isoform 1.1 Publication

<p>This subsection of the 'Expression' section reports the experimentally proven effects of inducers and repressors (usually chemical compounds or environmental factors) on the level of protein (or mRNA) expression (up-regulation, down-regulation, constitutive expression).<p><a href='/help/induction' target='_top'>More...</a></p>Inductioni

Expression decreases in response to peroxisome proliferators.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSMUSG00000031767, Expressed in liver and 279 other tissues

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q99P30, MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

Protein interaction database and analysis system

More...IntActi		Q99P30, 2 interactors

Molecular INTeraction database

More...MINTi		Q99P30

STRING: functional protein association networks

More...STRINGi		10090.ENSMUSP00000073213

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		Q99P30, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		Q99P30

Database of comparative protein structure models

More...ModBasei		Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini37 – 169Nudix hydrolasePROSITE-ProRule annotationAdd BLAST133

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi77 – 98Nudix boxAdd BLAST22
Motifi234 – 236Microbody targeting signalCurated3

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the Nudix hydrolase family. PCD1 subfamily.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG3069, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00940000159631

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_040940_6_0_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q99P30

Identification of Orthologs from Complete Genome Data

More...OMAi		CFEYTDP

Database of Orthologous Groups

More...OrthoDBi		1253012at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q99P30

TreeFam database of animal gene trees

More...TreeFami		TF106350

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR015797, NUDIX_hydrolase-like_dom_sf
IPR000086, NUDIX_hydrolase_dom
IPR000059, NUDIX_hydrolase_NudL_CS

Pfam protein domain database

More...Pfami		View protein in Pfam
PF00293, NUDIX, 1 hit

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF55811, SSF55811, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS51462, NUDIX, 1 hit
PS01293, NUDIX_COA, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (5)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 5 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: Q99P30-1) [UniParc]FASTAAdd to basket
Also known as: Alpha, Nudt7alpha1 Publication

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSRPCGLPEP VRNNLIDDAK ARLRKSDVGT RYSHLSSNKF SVLVPLLARG 
        60         70         80         90        100
GKLYLMFTVR SDKLKREPGE VCFPGGKRDP VDTDDTATAL REAQEEVGLH 
       110        120        130        140        150
PHQVEVVSHL VPYVFDNDAL VTPVVGFLDH NFQAQPNADE VKEVFFVPLD 
       160        170        180        190        200
YFLHPQVYYQ KQITQSGRDF IMHCFEYKDP ETGVNYLIQG MTSKLAVLVA 
       210        220        230 
LIILEQSPAF KIDFDLHDLI PSCERTFLWR YSLSKL
Length:236
Mass (Da):26,857
Last modified:July 19, 2005 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i37A22A9135F8F9ED
GO
Isoform 2 (identifier: Q99P30-2) [UniParc]FASTAAdd to basket
Also known as: Beta, Nudt7beta, Nudt7gamma1 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     1-12: MSRPCGLPEPVR → MVQSLELPQRQPCHFGSWIKRSPSGLTSKSPSQVLG

Note: Inactive.Curated
Show »
Length:260
Mass (Da):29,483
Checksum:i4628AE9515DFE51D
GO
Isoform 3 (identifier: Q99P30-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     97-116: Missing.

Show »
Length:216
Mass (Da):24,603
Checksum:iDAD12342CC9E4253
GO
Isoform 4 (identifier: Q99P30-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-63: MSRPCGLPEP...YLMFTVRSDK → MRVRTICFPKSPAASKRKYCRADVATLWTPGACQ

Show »
Length:207
Mass (Da):23,594
Checksum:i426BD0BFC3F31976
GO
Isoform 5 (identifier: Q99P30-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     117-171: NDALVTPVVG...QITQSGRDFI → VRTGMGPPEL...IQEERGEPPQ
     172-236: Missing.

Show »
Length:171
Mass (Da):18,648
Checksum:iC0859920B44BB0DD
GO

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAH33046 differs from that shown. Reason: Erroneous initiation. Truncated N-terminus.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti161K → E in AAK07483 (PubMed:11415433).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0142711 – 63MSRPC…VRSDK → MRVRTICFPKSPAASKRKYC RADVATLWTPGACQ in isoform 4. 1 PublicationAdd BLAST63
Alternative sequenceiVSP_0142721 – 12MSRPC…PEPVR → MVQSLELPQRQPCHFGSWIK RSPSGLTSKSPSQVLG in isoform 2. 2 PublicationsAdd BLAST12
Alternative sequenceiVSP_01427397 – 116Missing in isoform 3. 1 PublicationAdd BLAST20
Alternative sequenceiVSP_014274117 – 171NDALV…GRDFI → VRTGMGPPELSGASTKFPNT LGTEPGELSPCVDSVLCELC GPSHSIQEERGEPPQ in isoform 5. 1 PublicationAdd BLAST55
Alternative sequenceiVSP_014275172 – 236Missing in isoform 5. 1 PublicationAdd BLAST65

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AF338424 mRNA Translation: AAK07483.1
AK004924 mRNA Translation: BAB23675.1
AK011172 mRNA Translation: BAB27446.1
AK088191 mRNA Translation: BAC40199.1
BC033046 mRNA Translation: AAH33046.1 Different initiation.
BC069843 mRNA Translation: AAH69843.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS22687.1 [Q99P30-1]
CCDS22688.2 [Q99P30-3]
CCDS80934.1 [Q99P30-5]
CCDS80935.1 [Q99P30-2]

NCBI Reference Sequences

More...RefSeqi		NP_001277109.1, NM_001290180.1
NP_001277110.1, NM_001290181.1 [Q99P30-2]
NP_001277111.1, NM_001290182.1 [Q99P30-5]
NP_077757.2, NM_024437.4 [Q99P30-1]
NP_077766.3, NM_024446.5 [Q99P30-3]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENSMUST00000066514; ENSMUSP00000065791; ENSMUSG00000031767 [Q99P30-4]
ENSMUST00000073521; ENSMUSP00000073213; ENSMUSG00000031767 [Q99P30-1]
ENSMUST00000109109; ENSMUSP00000104737; ENSMUSG00000031767 [Q99P30-2]
ENSMUST00000134593; ENSMUSP00000116868; ENSMUSG00000031767 [Q99P30-5]
ENSMUST00000147605; ENSMUSP00000114598; ENSMUSG00000031767 [Q99P30-3]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		67528

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		mmu:67528

UCSC genome browser

More...UCSCi		uc009nnv.3, mouse [Q99P30-5]
uc009nnw.3, mouse [Q99P30-1]
uc009nny.3, mouse [Q99P30-3]
uc012glf.2, mouse [Q99P30-4]
uc057and.1, mouse [Q99P30-2]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF338424 mRNA Translation: AAK07483.1
AK004924 mRNA Translation: BAB23675.1
AK011172 mRNA Translation: BAB27446.1
AK088191 mRNA Translation: BAC40199.1
BC033046 mRNA Translation: AAH33046.1 Different initiation.
BC069843 mRNA Translation: AAH69843.1
CCDSiCCDS22687.1 [Q99P30-1]
CCDS22688.2 [Q99P30-3]
CCDS80934.1 [Q99P30-5]
CCDS80935.1 [Q99P30-2]
RefSeqiNP_001277109.1, NM_001290180.1
NP_001277110.1, NM_001290181.1 [Q99P30-2]
NP_001277111.1, NM_001290182.1 [Q99P30-5]
NP_077757.2, NM_024437.4 [Q99P30-1]
NP_077766.3, NM_024446.5 [Q99P30-3]

3D structure databases

SMRiQ99P30
ModBaseiSearch...

Protein-protein interaction databases

IntActiQ99P30, 2 interactors
MINTiQ99P30
STRINGi10090.ENSMUSP00000073213

Chemistry databases

SwissLipidsiSLP:000001595 [Q99P30-1]

PTM databases

iPTMnetiQ99P30
PhosphoSitePlusiQ99P30
SwissPalmiQ99P30

2D gel databases

REPRODUCTION-2DPAGEiQ99P30

Proteomic databases

jPOSTiQ99P30
PaxDbiQ99P30
PeptideAtlasiQ99P30
PRIDEiQ99P30

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		48153, 29 antibodies

Genome annotation databases

EnsembliENSMUST00000066514; ENSMUSP00000065791; ENSMUSG00000031767 [Q99P30-4]
ENSMUST00000073521; ENSMUSP00000073213; ENSMUSG00000031767 [Q99P30-1]
ENSMUST00000109109; ENSMUSP00000104737; ENSMUSG00000031767 [Q99P30-2]
ENSMUST00000134593; ENSMUSP00000116868; ENSMUSG00000031767 [Q99P30-5]
ENSMUST00000147605; ENSMUSP00000114598; ENSMUSG00000031767 [Q99P30-3]
GeneIDi67528
KEGGimmu:67528
UCSCiuc009nnv.3, mouse [Q99P30-5]
uc009nnw.3, mouse [Q99P30-1]
uc009nny.3, mouse [Q99P30-3]
uc012glf.2, mouse [Q99P30-4]
uc057and.1, mouse [Q99P30-2]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		283927
MGIiMGI:1914778, Nudt7

Phylogenomic databases

eggNOGiKOG3069, Eukaryota
GeneTreeiENSGT00940000159631
HOGENOMiCLU_040940_6_0_1
InParanoidiQ99P30
OMAiCFEYTDP
OrthoDBi1253012at2759
PhylomeDBiQ99P30
TreeFamiTF106350

Enzyme and pathway databases

ReactomeiR-MMU-9033241, Peroxisomal protein import

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		67528, 0 hits in 16 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		Nudt7, mouse

Protein Ontology

More...PROi		PR:Q99P30
RNActiQ99P30, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSMUSG00000031767, Expressed in liver and 279 other tissues
GenevisibleiQ99P30, MM

Family and domain databases

InterProiView protein in InterPro
IPR015797, NUDIX_hydrolase-like_dom_sf
IPR000086, NUDIX_hydrolase_dom
IPR000059, NUDIX_hydrolase_NudL_CS
PfamiView protein in Pfam
PF00293, NUDIX, 1 hit
SUPFAMiSSF55811, SSF55811, 1 hit
PROSITEiView protein in PROSITE
PS51462, NUDIX, 1 hit
PS01293, NUDIX_COA, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiNUDT7_MOUSE
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q99P30
Secondary accession number(s): Q6IS65
, Q8BU08, Q8K260, Q9D0Q3, Q9DBI9
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 19, 2005
Last sequence update: July 19, 2005
Last modified: February 10, 2021
This is version 130 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again