Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - Q99P30 (NUDT7_MOUSE)

Entry version 120 (16 Jan 2019)
Sequence version 2 (19 Jul 2005)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Peroxisomal coenzyme A diphosphatase NUDT7

Gene

Nudt7

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Coenzyme A diphosphatase which mediates the cleavage of CoA, CoA esters and oxidized CoA with similar efficiencies, yielding 3',5'-ADP and the corresponding 4'-phosphopantetheine derivative as products. CoA into 3',5'-ADP and 4'-phosphopantetheine. Has no activity toward NDP-sugars, CDP-alcohols, (deoxy)nucleoside 5'-triphosphates, nucleoside 5'-di or monophosphates, diadenosine polyphosphates, NAD, NADH, NADP, NADPH or thymidine-5'-monophospho-p-nitrophenyl ester. May be required to eliminate oxidized CoA from peroxisomes, or regulate CoA and acyl-CoA levels in this organelle in response to metabolic demand. Does not play a role in U8 snoRNA decapping activity. Binds U8 snoRNA.1 Publication

<p>This subsection of the ‘Function’ section provides information relevant to cofactors. A cofactor is any non-protein substance required for a protein to be catalytically active. Some cofactors are inorganic, such as the metal atoms zinc, iron, and copper in various oxidation states. Others, such as most vitamins, are organic.<p><a href='/help/cofactor' target='_top'>More...</a></p>Cofactori

Mn2+1 Publication, Mg2+1 Publication

<p>This subsection of the ‘Function’ section describes regulatory mechanisms for enzymes, transporters or microbial transcription factors, and reports the components which regulate (by activation or inhibition) the reaction.<p><a href='/help/activity_regulation' target='_top'>More...</a></p>Activity regulationi

Inhibited by fluoride.

<p>This subsection of the ‘Function’ section describes biophysical and chemical properties, such as maximal absorption, kinetic parameters, pH dependence, redox potentials and temperature dependence.<p><a href='/help/biophysicochemical_properties' target='_top'>More...</a></p>Kineticsi

  1. KM=0.240 mM for CoA1 Publication
  2. KM=0.430 mM for Acetyl-CoA1 Publication
  3. KM=0235 mM for CoA-S-S-CoA1 Publication
  4. KM=0.330 mM for Succinyl-CoA1 Publication
  5. KM=0.480 mM for 3'-dephospho-CoA1 Publication

    pH dependencei

    Optimum pH is 8.1 Publication

    Sites

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the ‘Function’ section indicates at which position the protein binds a given metal ion. The nature of the metal is indicated in the ‘Description’ field.<p><a href='/help/metal' target='_top'>More...</a></p>Metal bindingi92Magnesium or manganeseBy similarity1
    Metal bindingi96Magnesium or manganeseBy similarity1

    <p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

    View the complete GO annotation on QuickGO ...

    GO - Biological processi

    View the complete GO annotation on QuickGO ...

    <p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

    Molecular functionHydrolase, RNA-binding
    LigandMagnesium, Manganese, Metal-binding

    Enzyme and pathway databases

    Reactome - a knowledgebase of biological pathways and processes

    More...    Reactomei    		R-MMU-390918 Peroxisomal lipid metabolism
    R-MMU-9033241 Peroxisomal protein import

    Chemistry databases

    SwissLipids knowledge resource for lipid biology

    More...    SwissLipidsi    		SLP:000001595 [Q99P30-1]

    <p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

    <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
    Recommended name:
    Peroxisomal coenzyme A diphosphatase NUDT7 (EC:3.6.1.-)
    Alternative name(s):
    Nucleoside diphosphate-linked moiety X motif 7
    Short name:
    Nudix motif 7
    <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
    Name:Nudt7
    <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
    <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
    <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Myomorpha › Muroidea › Muridae › Murinae › Mus › Mus
    <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
    • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 8

    Organism-specific databases

    Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

    More...    MGIi    		MGI:1914778 Nudt7

    <p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

    Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

    Keywords - Cellular componenti

    Peroxisome

    <p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

    Molecule processing

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000571411 – 236Peroxisomal coenzyme A diphosphatase NUDT7Add BLAST236

    Amino acid modifications

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei20N6-succinyllysineCombined sources1
    Modified residuei178N6-succinyllysineCombined sources1

    Proteomic databases

    jPOST - Japan Proteome Standard Repository/Database

    More...    jPOSTi    		Q99P30

    PaxDb, a database of protein abundance averages across all three domains of life

    More...    PaxDbi    		Q99P30

    PeptideAtlas

    More...    PeptideAtlasi    		Q99P30

    PRoteomics IDEntifications database

    More...    PRIDEi    		Q99P30

    2D gel databases

    REPRODUCTION-2DPAGE

    More...    REPRODUCTION-2DPAGEi    		Q99P30

    PTM databases

    iPTMnet integrated resource for PTMs in systems biology context

    More...    iPTMneti    		Q99P30

    Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

    More...    PhosphoSitePlusi    		Q99P30

    SwissPalm database of S-palmitoylation events

    More...    SwissPalmi    		Q99P30

    <p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

    <p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

    Highly expressed in liver. Expressed at intermediate level in lung and kidney and at low level in brain and heart.1 Publication

    Gene expression databases

    Bgee dataBase for Gene Expression Evolution

    More...    Bgeei    		ENSMUSG00000031767 Expressed in 263 organ(s), highest expression level in liver

    Genevisible search portal to normalized and curated expression data from Genevestigator

    More...    Genevisiblei    		Q99P30 MM

    <p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

    GO - Molecular functioni

    View the complete GO annotation on QuickGO ...

    Protein-protein interaction databases

    Protein interaction database and analysis system

    More...    IntActi    		Q99P30, 2 interactors

    Molecular INTeraction database

    More...    MINTi    		Q99P30

    STRING: functional protein association networks

    More...    STRINGi    		10090.ENSMUSP00000073213

    <p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

    3D structure databases

    Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

    More...    ProteinModelPortali    		Q99P30

    SWISS-MODEL Repository - a database of annotated 3D protein structure models

    More...    SMRi    		Q99P30

    Database of comparative protein structure models

    More...    ModBasei    		Search...

    MobiDB: a database of protein disorder and mobility annotations

    More...    MobiDBi    		Search...

    <p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini37 – 169Nudix hydrolasePROSITE-ProRule annotationAdd BLAST133

    Motif

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the ‘Family and Domains’ section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi77 – 98Nudix boxAdd BLAST22
    Motifi234 – 236Microbody targeting signalCurated3

    <p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

    Belongs to the Nudix hydrolase family. PCD1 subfamily.Curated

    Phylogenomic databases

    evolutionary genealogy of genes: Non-supervised Orthologous Groups

    More...    eggNOGi    		KOG3069 Eukaryota
    COG0494 LUCA

    Ensembl GeneTree

    More...    GeneTreei    		ENSGT00940000159631

    The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

    More...    HOGENOMi    		HOG000250455

    The HOVERGEN Database of Homologous Vertebrate Genes

    More...    HOVERGENi    		HBG082067

    InParanoid: Eukaryotic Ortholog Groups

    More...    InParanoidi    		Q99P30

    KEGG Orthology (KO)

    More...    KOi    		K17879

    Identification of Orthologs from Complete Genome Data

    More...    OMAi    		YFLHPRV

    Database of Orthologous Groups

    More...    OrthoDBi    		1253012at2759

    Database for complete collections of gene phylogenies

    More...    PhylomeDBi    		Q99P30

    TreeFam database of animal gene trees

    More...    TreeFami    		TF106350

    Family and domain databases

    Integrated resource of protein families, domains and functional sites

    More...    InterProi    		View protein in InterPro
    IPR015797 NUDIX_hydrolase-like_dom_sf
    IPR000086 NUDIX_hydrolase_dom
    IPR000059 NUDIX_hydrolase_NudL_CS

    Pfam protein domain database

    More...    Pfami    		View protein in Pfam
    PF00293 NUDIX, 1 hit

    Superfamily database of structural and functional annotation

    More...    SUPFAMi    		SSF55811 SSF55811, 1 hit

    PROSITE; a protein domain and family database

    More...    PROSITEi    		View protein in PROSITE
    PS51462 NUDIX, 1 hit
    PS01293 NUDIX_COA, 1 hit

    <p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (5)i

    <p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

    This entry describes 5 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
    Isoform 1 (identifier: Q99P30-1) [UniParc]FASTAAdd to basket
    Also known as: Alpha, Nudt7alpha

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide
            10         20         30         40         50
    MSRPCGLPEP VRNNLIDDAK ARLRKSDVGT RYSHLSSNKF SVLVPLLARG 
            60         70         80         90        100
    GKLYLMFTVR SDKLKREPGE VCFPGGKRDP VDTDDTATAL REAQEEVGLH 
           110        120        130        140        150
    PHQVEVVSHL VPYVFDNDAL VTPVVGFLDH NFQAQPNADE VKEVFFVPLD 
           160        170        180        190        200
    YFLHPQVYYQ KQITQSGRDF IMHCFEYKDP ETGVNYLIQG MTSKLAVLVA 
           210        220        230 
    LIILEQSPAF KIDFDLHDLI PSCERTFLWR YSLSKL
    Length:236
    Mass (Da):26,857
    Last modified:July 19, 2005 - v2
    <p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i37A22A9135F8F9ED
    GO
    Isoform 2 (identifier: Q99P30-2) [UniParc]FASTAAdd to basket
    Also known as: Beta, Nudt7beta

    The sequence of this isoform differs from the canonical sequence as follows:
         1-12: MSRPCGLPEPVR → MVQSLELPQRQPCHFGSWIKRSPSGLTSKSPSQVLG

    Note: Inactive.
    Show »
    Length:260
    Mass (Da):29,483
    Checksum:i4628AE9515DFE51D
    GO
    Isoform 3 (identifier: Q99P30-3) [UniParc]FASTAAdd to basket

    The sequence of this isoform differs from the canonical sequence as follows:
         97-116: Missing.

    Note: No experimental confirmation available.
    Show »
    Length:216
    Mass (Da):24,603
    Checksum:iDAD12342CC9E4253
    GO
    Isoform 4 (identifier: Q99P30-4) [UniParc]FASTAAdd to basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-63: MSRPCGLPEP...YLMFTVRSDK → MRVRTICFPKSPAASKRKYCRADVATLWTPGACQ

    Note: No experimental confirmation available.
    Show »
    Length:207
    Mass (Da):23,594
    Checksum:i426BD0BFC3F31976
    GO
    Isoform 5 (identifier: Q99P30-5) [UniParc]FASTAAdd to basket

    The sequence of this isoform differs from the canonical sequence as follows:
         117-171: NDALVTPVVG...QITQSGRDFI → VRTGMGPPEL...IQEERGEPPQ
         172-236: Missing.

    Note: No experimental confirmation available.
    Show »
    Length:171
    Mass (Da):18,648
    Checksum:iC0859920B44BB0DD
    GO

    <p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

    The sequence AAH33046 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

    Experimental Info

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti161K → E in AAK07483 (PubMed:11415433).Curated1

    Alternative sequence

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0142711 – 63MSRPC…VRSDK → MRVRTICFPKSPAASKRKYC RADVATLWTPGACQ in isoform 4. 1 PublicationAdd BLAST63
    Alternative sequenceiVSP_0142721 – 12MSRPC…PEPVR → MVQSLELPQRQPCHFGSWIK RSPSGLTSKSPSQVLG in isoform 2. 2 PublicationsAdd BLAST12
    Alternative sequenceiVSP_01427397 – 116Missing in isoform 3. 1 PublicationAdd BLAST20
    Alternative sequenceiVSP_014274117 – 171NDALV…GRDFI → VRTGMGPPELSGASTKFPNT LGTEPGELSPCVDSVLCELC GPSHSIQEERGEPPQ in isoform 5. 1 PublicationAdd BLAST55
    Alternative sequenceiVSP_014275172 – 236Missing in isoform 5. 1 PublicationAdd BLAST65

    Sequence databases

    Select the link destinations:

    EMBL nucleotide sequence database

    More...    EMBLi

    GenBank nucleotide sequence database

    More...    GenBanki

    DNA Data Bank of Japan; a nucleotide sequence database

    More...    DDBJi
    Links Updated
    		AF338424 mRNA Translation: AAK07483.1
    AK004924 mRNA Translation: BAB23675.1
    AK011172 mRNA Translation: BAB27446.1
    AK088191 mRNA Translation: BAC40199.1
    BC033046 mRNA Translation: AAH33046.1 Different initiation.
    BC069843 mRNA Translation: AAH69843.1

    The Consensus CDS (CCDS) project

    More...    CCDSi    		CCDS22687.1 [Q99P30-1]
    CCDS22688.2 [Q99P30-3]
    CCDS80933.1 [Q99P30-4]
    CCDS80934.1 [Q99P30-5]
    CCDS80935.1 [Q99P30-2]

    NCBI Reference Sequences

    More...    RefSeqi    		NP_001277109.1, NM_001290180.1 [Q99P30-4]
    NP_001277110.1, NM_001290181.1 [Q99P30-2]
    NP_001277111.1, NM_001290182.1 [Q99P30-5]
    NP_077757.2, NM_024437.4 [Q99P30-1]
    NP_077766.3, NM_024446.5 [Q99P30-3]

    UniGene gene-oriented nucleotide sequence clusters

    More...    UniGenei    		Mm.27889

    Genome annotation databases

    Ensembl eukaryotic genome annotation project

    More...    Ensembli    		ENSMUST00000066514; ENSMUSP00000065791; ENSMUSG00000031767 [Q99P30-4]
    ENSMUST00000073521; ENSMUSP00000073213; ENSMUSG00000031767 [Q99P30-1]
    ENSMUST00000109109; ENSMUSP00000104737; ENSMUSG00000031767 [Q99P30-2]
    ENSMUST00000134593; ENSMUSP00000116868; ENSMUSG00000031767 [Q99P30-5]
    ENSMUST00000147605; ENSMUSP00000114598; ENSMUSG00000031767 [Q99P30-3]

    Database of genes from NCBI RefSeq genomes

    More...    GeneIDi    		67528

    KEGG: Kyoto Encyclopedia of Genes and Genomes

    More...    KEGGi    		mmu:67528

    UCSC genome browser

    More...    UCSCi    		uc009nnv.3 mouse [Q99P30-5]
    uc009nnw.3 mouse [Q99P30-1]
    uc009nny.3 mouse [Q99P30-3]
    uc012glf.2 mouse [Q99P30-4]
    uc057and.1 mouse [Q99P30-2]

    Keywords - Coding sequence diversityi

    Alternative splicing

    <p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

    <p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBLi
    GenBanki
    DDBJi
    Links Updated
    		AF338424 mRNA Translation: AAK07483.1
    AK004924 mRNA Translation: BAB23675.1
    AK011172 mRNA Translation: BAB27446.1
    AK088191 mRNA Translation: BAC40199.1
    BC033046 mRNA Translation: AAH33046.1 Different initiation.
    BC069843 mRNA Translation: AAH69843.1
    CCDSiCCDS22687.1 [Q99P30-1]
    CCDS22688.2 [Q99P30-3]
    CCDS80933.1 [Q99P30-4]
    CCDS80934.1 [Q99P30-5]
    CCDS80935.1 [Q99P30-2]
    RefSeqiNP_001277109.1, NM_001290180.1 [Q99P30-4]
    NP_001277110.1, NM_001290181.1 [Q99P30-2]
    NP_001277111.1, NM_001290182.1 [Q99P30-5]
    NP_077757.2, NM_024437.4 [Q99P30-1]
    NP_077766.3, NM_024446.5 [Q99P30-3]
    UniGeneiMm.27889

    3D structure databases

    ProteinModelPortaliQ99P30
    SMRiQ99P30
    ModBaseiSearch...
    MobiDBiSearch...

    Protein-protein interaction databases

    IntActiQ99P30, 2 interactors
    MINTiQ99P30
    STRINGi10090.ENSMUSP00000073213

    Chemistry databases

    SwissLipidsiSLP:000001595 [Q99P30-1]

    PTM databases

    iPTMnetiQ99P30
    PhosphoSitePlusiQ99P30
    SwissPalmiQ99P30

    2D gel databases

    REPRODUCTION-2DPAGEiQ99P30

    Proteomic databases

    jPOSTiQ99P30
    PaxDbiQ99P30
    PeptideAtlasiQ99P30
    PRIDEiQ99P30

    Protocols and materials databases

    Structural Biology KnowledgebaseSearch...

    Genome annotation databases

    EnsembliENSMUST00000066514; ENSMUSP00000065791; ENSMUSG00000031767 [Q99P30-4]
    ENSMUST00000073521; ENSMUSP00000073213; ENSMUSG00000031767 [Q99P30-1]
    ENSMUST00000109109; ENSMUSP00000104737; ENSMUSG00000031767 [Q99P30-2]
    ENSMUST00000134593; ENSMUSP00000116868; ENSMUSG00000031767 [Q99P30-5]
    ENSMUST00000147605; ENSMUSP00000114598; ENSMUSG00000031767 [Q99P30-3]
    GeneIDi67528
    KEGGimmu:67528
    UCSCiuc009nnv.3 mouse [Q99P30-5]
    uc009nnw.3 mouse [Q99P30-1]
    uc009nny.3 mouse [Q99P30-3]
    uc012glf.2 mouse [Q99P30-4]
    uc057and.1 mouse [Q99P30-2]

    Organism-specific databases

    Comparative Toxicogenomics Database

    More...    CTDi    		283927
    MGIiMGI:1914778 Nudt7

    Phylogenomic databases

    eggNOGiKOG3069 Eukaryota
    COG0494 LUCA
    GeneTreeiENSGT00940000159631
    HOGENOMiHOG000250455
    HOVERGENiHBG082067
    InParanoidiQ99P30
    KOiK17879
    OMAiYFLHPRV
    OrthoDBi1253012at2759
    PhylomeDBiQ99P30
    TreeFamiTF106350

    Enzyme and pathway databases

    ReactomeiR-MMU-390918 Peroxisomal lipid metabolism
    R-MMU-9033241 Peroxisomal protein import

    Miscellaneous databases

    Protein Ontology

    More...    PROi    		PR:Q99P30

    The Stanford Online Universal Resource for Clones and ESTs

    More...    SOURCEi    		Search...

    Gene expression databases

    BgeeiENSMUSG00000031767 Expressed in 263 organ(s), highest expression level in liver
    GenevisibleiQ99P30 MM

    Family and domain databases

    InterProiView protein in InterPro
    IPR015797 NUDIX_hydrolase-like_dom_sf
    IPR000086 NUDIX_hydrolase_dom
    IPR000059 NUDIX_hydrolase_NudL_CS
    PfamiView protein in Pfam
    PF00293 NUDIX, 1 hit
    SUPFAMiSSF55811 SSF55811, 1 hit
    PROSITEiView protein in PROSITE
    PS51462 NUDIX, 1 hit
    PS01293 NUDIX_COA, 1 hit

    ProtoNet; Automatic hierarchical classification of proteins

    More...    ProtoNeti    		Search...

    <p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

    <p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiNUDT7_MOUSE
    <p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q99P30
    Secondary accession number(s): Q6IS65
    , Q8BU08, Q8K260, Q9D0Q3, Q9DBI9
    <p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 19, 2005
    Last sequence update: July 19, 2005
    Last modified: January 16, 2019
    This is version 120 of the entry and version 2 of the sequence. See complete history.
    <p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program

    <p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. SIMILARITY comments
      Index of protein domains and families
    2. MGD cross-references
      Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
    UniProt is an ELIXIR core data resource
    Main funding by: National Institutes of Health

    We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

    Do not show this banner again