Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Suppressor of tumorigenicity 7 protein

Gene

St7

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at transcript leveli

Names & Taxonomyi

Protein namesi
Recommended name:
Suppressor of tumorigenicity 7 protein
Alternative name(s):
mRay
Gene namesi
Name:St7
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 6

Organism-specific databases

MGIiMGI:1927450 St7

Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Transmembranei15 – 35HelicalSequence analysisAdd BLAST21
Transmembranei62 – 82HelicalSequence analysisAdd BLAST21
Transmembranei512 – 532HelicalSequence analysisAdd BLAST21
Transmembranei539 – 559HelicalSequence analysisAdd BLAST21

Keywords - Cellular componenti

Membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00003392071 – 577Suppressor of tumorigenicity 7 proteinAdd BLAST577

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Glycosylationi47N-linked (GlcNAc...) asparagineSequence analysis1
Modified residuei386PhosphoserineBy similarity1

Keywords - PTMi

Glycoprotein, Phosphoprotein

Proteomic databases

PaxDbiQ99M96
PRIDEiQ99M96

PTM databases

iPTMnetiQ99M96
PhosphoSitePlusiQ99M96

Expressioni

Gene expression databases

BgeeiENSMUSG00000029534 Expressed in 239 organ(s), highest expression level in ear
ExpressionAtlasiQ99M96 baseline and differential
GenevisibleiQ99M96 MM

Interactioni

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000057326

Structurei

3D structure databases

ProteinModelPortaliQ99M96
SMRiQ99M96
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the ST7 family.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG3807 Eukaryota
ENOG410XQ2Z LUCA
GeneTreeiENSGT00390000000873
HOVERGENiHBG054916
InParanoidiQ99M96
OMAiPIMNVLN
OrthoDBiEOG091G05WJ
PhylomeDBiQ99M96
TreeFamiTF314162

Family and domain databases

CDDicd11557 ST7, 1 hit
Gene3Di1.25.40.10, 1 hit
InterProiView protein in InterPro
IPR007311 ST7
IPR011990 TPR-like_helical_dom_sf
PANTHERiPTHR12745 PTHR12745, 1 hit
PfamiView protein in Pfam
PF04184 ST7, 1 hit

Sequences (9+)i

Sequence statusi: Complete.

This entry describes 9 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 9 described isoforms and 5 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q99M96-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAEAGAGFLE QLKSCIVWSW TYLWTVWFFL VLFLVYILRV PLRINDNLST
60 70 80 90 100
VSMFLNTLTP KFYVALTGTS SLISGLILIF EWWYFRKYGT SFIEQVSVSH
110 120 130 140 150
LRPLLGGVDN NSSNNSNSSN GDSDSNRQSV SECKVWRNPL NLFRGAEYNR
160 170 180 190 200
YTWVTGREPL TYYDMNLSAQ DHQTFFTCDS DHLRPADAIM QKAWRERNPQ
210 220 230 240 250
ARISAAHEAL EINEIRSRVE VPLIASSTIW EIKLLPKCAT AYILLAEEEA
260 270 280 290 300
TTIAEAEKLF KQALKAGDGC YRRSQQLQHH GSQYEAQHRR DTNVLVYIKR
310 320 330 340 350
RLAMCARRLG RTREAVKMMR DLMKEFPLLS MFNIHENLLE ALLELQAYAD
360 370 380 390 400
VQAVLAKYDD ISLPKSATIC YTAALLKARA VSDKFSPEAA SRRGLSTAEM
410 420 430 440 450
NAVEAIHRAV EFNPHVPKYL LEMKSLILPP EHILKRGDSE AIAYAFFHLA
460 470 480 490 500
HWKRVEGALN LLHCTWEGTF RMIPYPLEKG HLFYPYPICT ETADRELLPS
510 520 530 540 550
FHEVSVYPKK ELPFFILFTA GLCSFTAMLA LLTHQFPELM GVFAKAFLST
560 570
LFAPLNFVME KVESILPSSL WHQLTRI
Length:577
Mass (Da):66,095
Last modified:June 1, 2001 - v1
Checksum:i23E90053FAEBB71F
GO
Isoform 2 (identifier: Q99M96-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     464-469: CTWEGT → S

Show »
Length:572
Mass (Da):65,505
Checksum:i800B3B7052A20B1C
GO
Isoform 3 (identifier: Q99M96-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     215-237: Missing.

Show »
Length:554
Mass (Da):63,464
Checksum:iA65B3610D2525701
GO
Isoform 4 (identifier: Q99M96-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-51: MAEAGAGFLE...LRINDNLSTV → MQEGKQITCSHVKLLPSRLPEHAFM
     215-237: Missing.

Show »
Length:528
Mass (Da):60,321
Checksum:iD3A25B6A12F40666
GO
Isoform 5 (identifier: Q99M96-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-51: MAEAGAGFLE...LRINDNLSTV → MQEGKQITCSHVKLLPSRLPEHAFM

Show »
Length:551
Mass (Da):62,953
Checksum:i65A172902C8C6FB4
GO
Isoform 6 (identifier: Q99M96-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-19: Missing.
     20-50: WTYLWTVWFFLVLFLVYILRVPLRINDNLST → MKYA

Show »
Length:531
Mass (Da):60,682
Checksum:i7BE7FD826A2A45BB
GO
Isoform 7 (identifier: Q99M96-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-19: Missing.
     20-50: WTYLWTVWFFLVLFLVYILRVPLRINDNLST → MKYA
     215-237: Missing.

Show »
Length:508
Mass (Da):58,051
Checksum:i66A46480F5CA3AEB
GO
Isoform 8 (identifier: Q99M96-8) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-26: Missing.
     27-51: WFFLVLFLVYILRVPLRINDNLSTV → MFGTESSL

Show »
Length:534
Mass (Da):60,942
Checksum:i3460D7C19A6CA82A
GO
Isoform 9 (identifier: Q99M96-9) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-26: Missing.
     27-51: WFFLVLFLVYILRVPLRINDNLSTV → MFGTESSL
     215-237: Missing.

Show »
Length:511
Mass (Da):58,311
Checksum:i0ECD998EB214827F
GO

Computationally mapped potential isoform sequencesi

There are 5 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
D3YUM7D3YUM7_MOUSE
Suppressor of tumorigenicity 7 prot...
St7
523Annotation score:
D3YUN2D3YUN2_MOUSE
Suppressor of tumorigenicity 7 prot...
St7
503Annotation score:
D6RGP5D6RGP5_MOUSE
Suppressor of tumorigenicity 7 prot...
St7
83Annotation score:
D6RHR0D6RHR0_MOUSE
Suppressor of tumorigenicity 7 prot...
St7
64Annotation score:
D6RFD8D6RFD8_MOUSE
Suppressor of tumorigenicity 7 prot...
St7
52Annotation score:

Sequence cautioni

The sequence AAH12719 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti102R → C in AAG24465 (PubMed:11279520).Curated1
Sequence conflicti102R → C in AAG24464 (PubMed:11279520).Curated1
Sequence conflicti308R → G in BAE30495 (PubMed:16141072).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0341181 – 51MAEAG…NLSTV → MQEGKQITCSHVKLLPSRLP EHAFM in isoform 4 and isoform 5. 1 PublicationAdd BLAST51
Alternative sequenceiVSP_0341191 – 26Missing in isoform 8 and isoform 9. 6 PublicationsAdd BLAST26
Alternative sequenceiVSP_0341201 – 19Missing in isoform 6 and isoform 7. 1 PublicationAdd BLAST19
Alternative sequenceiVSP_03412120 – 50WTYLW…DNLST → MKYA in isoform 6 and isoform 7. 1 PublicationAdd BLAST31
Alternative sequenceiVSP_03412227 – 51WFFLV…NLSTV → MFGTESSL in isoform 8 and isoform 9. 6 PublicationsAdd BLAST25
Alternative sequenceiVSP_034123215 – 237Missing in isoform 3, isoform 4, isoform 7 and isoform 9. 6 PublicationsAdd BLAST23
Alternative sequenceiVSP_034124464 – 469CTWEGT → S in isoform 2. 1 Publication6

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF234885 mRNA Translation: AAF85948.1
AF234884 mRNA Translation: AAF85947.1
AY007792 mRNA Translation: AAG24458.1
AY007794 mRNA Translation: AAG24460.1
AY007795 mRNA Translation: AAG24461.1
AY007796 mRNA Translation: AAG24462.1
AY007797 mRNA Translation: AAG24463.1
AY007798 mRNA Translation: AAG24464.1
AY007799 mRNA Translation: AAG24465.1
AY551821 mRNA Translation: AAS59839.1
AY551822 mRNA Translation: AAS59840.1
AK132103 mRNA Translation: BAE20983.1
AK151550 mRNA Translation: BAE30495.1
CT010245 mRNA Translation: CAJ18453.1
BC012719 mRNA Translation: AAH12719.1 Different initiation.
BC024652 mRNA Translation: AAH24652.1
BC108418 mRNA Translation: AAI08419.1
CCDSiCCDS19927.1 [Q99M96-8]
CCDS39431.1 [Q99M96-9]
CCDS71728.1 [Q99M96-1]
CCDS71729.1 [Q99M96-3]
CCDS71730.1 [Q99M96-6]
CCDS71731.1 [Q99M96-7]
CCDS80490.1 [Q99M96-2]
RefSeqiNP_001076784.1, NM_001083315.2 [Q99M96-9]
NP_001276553.1, NM_001289624.1 [Q99M96-1]
NP_001276554.1, NM_001289625.1 [Q99M96-2]
NP_001276556.1, NM_001289627.1 [Q99M96-6]
NP_001276558.1, NM_001289629.1 [Q99M96-7]
NP_071727.2, NM_022332.3 [Q99M96-8]
XP_011239376.1, XM_011241074.1 [Q99M96-1]
UniGeneiMm.12051

Genome annotation databases

EnsembliENSMUST00000000674; ENSMUSP00000000674; ENSMUSG00000029534 [Q99M96-7]
ENSMUST00000052113; ENSMUSP00000062886; ENSMUSG00000029534 [Q99M96-3]
ENSMUST00000053148; ENSMUSP00000057326; ENSMUSG00000029534 [Q99M96-8]
ENSMUST00000077080; ENSMUSP00000076334; ENSMUSG00000029534 [Q99M96-6]
ENSMUST00000081635; ENSMUSP00000080341; ENSMUSG00000029534 [Q99M96-1]
ENSMUST00000115417; ENSMUSP00000111077; ENSMUSG00000029534 [Q99M96-9]
ENSMUST00000115419; ENSMUSP00000111079; ENSMUSG00000029534 [Q99M96-2]
GeneIDi64213
KEGGimmu:64213
UCSCiuc009azu.2 mouse [Q99M96-2]
uc009azv.2 mouse [Q99M96-1]
uc009azx.2 mouse [Q99M96-7]
uc009azy.2 mouse [Q99M96-6]
uc009bac.2 mouse [Q99M96-8]
uc009bae.2 mouse [Q99M96-9]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF234885 mRNA Translation: AAF85948.1
AF234884 mRNA Translation: AAF85947.1
AY007792 mRNA Translation: AAG24458.1
AY007794 mRNA Translation: AAG24460.1
AY007795 mRNA Translation: AAG24461.1
AY007796 mRNA Translation: AAG24462.1
AY007797 mRNA Translation: AAG24463.1
AY007798 mRNA Translation: AAG24464.1
AY007799 mRNA Translation: AAG24465.1
AY551821 mRNA Translation: AAS59839.1
AY551822 mRNA Translation: AAS59840.1
AK132103 mRNA Translation: BAE20983.1
AK151550 mRNA Translation: BAE30495.1
CT010245 mRNA Translation: CAJ18453.1
BC012719 mRNA Translation: AAH12719.1 Different initiation.
BC024652 mRNA Translation: AAH24652.1
BC108418 mRNA Translation: AAI08419.1
CCDSiCCDS19927.1 [Q99M96-8]
CCDS39431.1 [Q99M96-9]
CCDS71728.1 [Q99M96-1]
CCDS71729.1 [Q99M96-3]
CCDS71730.1 [Q99M96-6]
CCDS71731.1 [Q99M96-7]
CCDS80490.1 [Q99M96-2]
RefSeqiNP_001076784.1, NM_001083315.2 [Q99M96-9]
NP_001276553.1, NM_001289624.1 [Q99M96-1]
NP_001276554.1, NM_001289625.1 [Q99M96-2]
NP_001276556.1, NM_001289627.1 [Q99M96-6]
NP_001276558.1, NM_001289629.1 [Q99M96-7]
NP_071727.2, NM_022332.3 [Q99M96-8]
XP_011239376.1, XM_011241074.1 [Q99M96-1]
UniGeneiMm.12051

3D structure databases

ProteinModelPortaliQ99M96
SMRiQ99M96
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000057326

PTM databases

iPTMnetiQ99M96
PhosphoSitePlusiQ99M96

Proteomic databases

PaxDbiQ99M96
PRIDEiQ99M96

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000000674; ENSMUSP00000000674; ENSMUSG00000029534 [Q99M96-7]
ENSMUST00000052113; ENSMUSP00000062886; ENSMUSG00000029534 [Q99M96-3]
ENSMUST00000053148; ENSMUSP00000057326; ENSMUSG00000029534 [Q99M96-8]
ENSMUST00000077080; ENSMUSP00000076334; ENSMUSG00000029534 [Q99M96-6]
ENSMUST00000081635; ENSMUSP00000080341; ENSMUSG00000029534 [Q99M96-1]
ENSMUST00000115417; ENSMUSP00000111077; ENSMUSG00000029534 [Q99M96-9]
ENSMUST00000115419; ENSMUSP00000111079; ENSMUSG00000029534 [Q99M96-2]
GeneIDi64213
KEGGimmu:64213
UCSCiuc009azu.2 mouse [Q99M96-2]
uc009azv.2 mouse [Q99M96-1]
uc009azx.2 mouse [Q99M96-7]
uc009azy.2 mouse [Q99M96-6]
uc009bac.2 mouse [Q99M96-8]
uc009bae.2 mouse [Q99M96-9]

Organism-specific databases

CTDi7982
MGIiMGI:1927450 St7

Phylogenomic databases

eggNOGiKOG3807 Eukaryota
ENOG410XQ2Z LUCA
GeneTreeiENSGT00390000000873
HOVERGENiHBG054916
InParanoidiQ99M96
OMAiPIMNVLN
OrthoDBiEOG091G05WJ
PhylomeDBiQ99M96
TreeFamiTF314162

Miscellaneous databases

ChiTaRSiSt7 mouse
PROiPR:Q99M96
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000029534 Expressed in 239 organ(s), highest expression level in ear
ExpressionAtlasiQ99M96 baseline and differential
GenevisibleiQ99M96 MM

Family and domain databases

CDDicd11557 ST7, 1 hit
Gene3Di1.25.40.10, 1 hit
InterProiView protein in InterPro
IPR007311 ST7
IPR011990 TPR-like_helical_dom_sf
PANTHERiPTHR12745 PTHR12745, 1 hit
PfamiView protein in Pfam
PF04184 ST7, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiST7_MOUSE
AccessioniPrimary (citable) accession number: Q99M96
Secondary accession number(s): Q3UA20
, Q6Q9W2, Q6Q9W3, Q8R3T3, Q921F6, Q99M89, Q99M90, Q99M91, Q99M92, Q99M93, Q99M94, Q9JID7, Q9JID8
Entry historyiIntegrated into UniProtKB/Swiss-Prot: June 10, 2008
Last sequence update: June 1, 2001
Last modified: September 12, 2018
This is version 115 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again