Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 121 (22 Apr 2020)
Sequence version 1 (01 Jun 2001)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Suppressor of tumorigenicity 7 protein

Gene

St7

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Suppressor of tumorigenicity 7 protein
Alternative name(s):
mRay
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:St7
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 6

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:1927450 St7

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei15 – 35HelicalSequence analysisAdd BLAST21
Transmembranei62 – 82HelicalSequence analysisAdd BLAST21
Transmembranei512 – 532HelicalSequence analysisAdd BLAST21
Transmembranei539 – 559HelicalSequence analysisAdd BLAST21

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Membrane

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003392071 – 577Suppressor of tumorigenicity 7 proteinAdd BLAST577

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi47N-linked (GlcNAc...) asparagineSequence analysis1
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei386PhosphoserineBy similarity1

Keywords - PTMi

Glycoprotein, Phosphoprotein

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q99M96

PRoteomics IDEntifications database

More...
PRIDEi
Q99M96

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q99M96

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q99M96

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSMUSG00000029534 Expressed in ear and 238 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q99M96 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q99M96 MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

STRING: functional protein association networks

More...
STRINGi
10090.ENSMUSP00000057326

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q99M96 protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q99M96

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the ST7 family.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG3807 Eukaryota
ENOG410XQ2Z LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000000873

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_035578_2_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q99M96

Identification of Orthologs from Complete Genome Data

More...
OMAi
WATNKEP

Database of Orthologous Groups

More...
OrthoDBi
540550at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q99M96

TreeFam database of animal gene trees

More...
TreeFami
TF314162

Family and domain databases

Conserved Domains Database

More...
CDDi
cd11557 ST7, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.25.40.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR007311 ST7
IPR011990 TPR-like_helical_dom_sf

The PANTHER Classification System

More...
PANTHERi
PTHR12745 PTHR12745, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF04184 ST7, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (9+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 9 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 9 described isoforms and 5 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q99M96-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAEAGAGFLE QLKSCIVWSW TYLWTVWFFL VLFLVYILRV PLRINDNLST
60 70 80 90 100
VSMFLNTLTP KFYVALTGTS SLISGLILIF EWWYFRKYGT SFIEQVSVSH
110 120 130 140 150
LRPLLGGVDN NSSNNSNSSN GDSDSNRQSV SECKVWRNPL NLFRGAEYNR
160 170 180 190 200
YTWVTGREPL TYYDMNLSAQ DHQTFFTCDS DHLRPADAIM QKAWRERNPQ
210 220 230 240 250
ARISAAHEAL EINEIRSRVE VPLIASSTIW EIKLLPKCAT AYILLAEEEA
260 270 280 290 300
TTIAEAEKLF KQALKAGDGC YRRSQQLQHH GSQYEAQHRR DTNVLVYIKR
310 320 330 340 350
RLAMCARRLG RTREAVKMMR DLMKEFPLLS MFNIHENLLE ALLELQAYAD
360 370 380 390 400
VQAVLAKYDD ISLPKSATIC YTAALLKARA VSDKFSPEAA SRRGLSTAEM
410 420 430 440 450
NAVEAIHRAV EFNPHVPKYL LEMKSLILPP EHILKRGDSE AIAYAFFHLA
460 470 480 490 500
HWKRVEGALN LLHCTWEGTF RMIPYPLEKG HLFYPYPICT ETADRELLPS
510 520 530 540 550
FHEVSVYPKK ELPFFILFTA GLCSFTAMLA LLTHQFPELM GVFAKAFLST
560 570
LFAPLNFVME KVESILPSSL WHQLTRI
Length:577
Mass (Da):66,095
Last modified:June 1, 2001 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i23E90053FAEBB71F
GO
Isoform 2 (identifier: Q99M96-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     464-469: CTWEGT → S

Show »
Length:572
Mass (Da):65,505
Checksum:i800B3B7052A20B1C
GO
Isoform 3 (identifier: Q99M96-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     215-237: Missing.

Show »
Length:554
Mass (Da):63,464
Checksum:iA65B3610D2525701
GO
Isoform 4 (identifier: Q99M96-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-51: MAEAGAGFLE...LRINDNLSTV → MQEGKQITCSHVKLLPSRLPEHAFM
     215-237: Missing.

Show »
Length:528
Mass (Da):60,321
Checksum:iD3A25B6A12F40666
GO
Isoform 5 (identifier: Q99M96-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-51: MAEAGAGFLE...LRINDNLSTV → MQEGKQITCSHVKLLPSRLPEHAFM

Show »
Length:551
Mass (Da):62,953
Checksum:i65A172902C8C6FB4
GO
Isoform 6 (identifier: Q99M96-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-19: Missing.
     20-50: WTYLWTVWFFLVLFLVYILRVPLRINDNLST → MKYA

Show »
Length:531
Mass (Da):60,682
Checksum:i7BE7FD826A2A45BB
GO
Isoform 7 (identifier: Q99M96-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-19: Missing.
     20-50: WTYLWTVWFFLVLFLVYILRVPLRINDNLST → MKYA
     215-237: Missing.

Show »
Length:508
Mass (Da):58,051
Checksum:i66A46480F5CA3AEB
GO
Isoform 8 (identifier: Q99M96-8) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-26: Missing.
     27-51: WFFLVLFLVYILRVPLRINDNLSTV → MFGTESSL

Show »
Length:534
Mass (Da):60,942
Checksum:i3460D7C19A6CA82A
GO
Isoform 9 (identifier: Q99M96-9) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-26: Missing.
     27-51: WFFLVLFLVYILRVPLRINDNLSTV → MFGTESSL
     215-237: Missing.

Show »
Length:511
Mass (Da):58,311
Checksum:i0ECD998EB214827F
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 5 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
D3YUM7D3YUM7_MOUSE
Suppressor of tumorigenicity 7 prot...
St7
523Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D3YUN2D3YUN2_MOUSE
Suppressor of tumorigenicity 7 prot...
St7
503Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D6RFD8D6RFD8_MOUSE
Suppressor of tumorigenicity 7 prot...
St7
52Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D6RGP5D6RGP5_MOUSE
Suppressor of tumorigenicity 7 prot...
St7
83Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D6RHR0D6RHR0_MOUSE
Suppressor of tumorigenicity 7 prot...
St7
64Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAH12719 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti102R → C in AAG24465 (PubMed:11279520).Curated1
Sequence conflicti102R → C in AAG24464 (PubMed:11279520).Curated1
Sequence conflicti308R → G in BAE30495 (PubMed:16141072).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0341181 – 51MAEAG…NLSTV → MQEGKQITCSHVKLLPSRLP EHAFM in isoform 4 and isoform 5. 1 PublicationAdd BLAST51
Alternative sequenceiVSP_0341191 – 26Missing in isoform 8 and isoform 9. 6 PublicationsAdd BLAST26
Alternative sequenceiVSP_0341201 – 19Missing in isoform 6 and isoform 7. 1 PublicationAdd BLAST19
Alternative sequenceiVSP_03412120 – 50WTYLW…DNLST → MKYA in isoform 6 and isoform 7. 1 PublicationAdd BLAST31
Alternative sequenceiVSP_03412227 – 51WFFLV…NLSTV → MFGTESSL in isoform 8 and isoform 9. 6 PublicationsAdd BLAST25
Alternative sequenceiVSP_034123215 – 237Missing in isoform 3, isoform 4, isoform 7 and isoform 9. 6 PublicationsAdd BLAST23
Alternative sequenceiVSP_034124464 – 469CTWEGT → S in isoform 2. 1 Publication6

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF234885 mRNA Translation: AAF85948.1
AF234884 mRNA Translation: AAF85947.1
AY007792 mRNA Translation: AAG24458.1
AY007794 mRNA Translation: AAG24460.1
AY007795 mRNA Translation: AAG24461.1
AY007796 mRNA Translation: AAG24462.1
AY007797 mRNA Translation: AAG24463.1
AY007798 mRNA Translation: AAG24464.1
AY007799 mRNA Translation: AAG24465.1
AY551821 mRNA Translation: AAS59839.1
AY551822 mRNA Translation: AAS59840.1
AK132103 mRNA Translation: BAE20983.1
AK151550 mRNA Translation: BAE30495.1
CT010245 mRNA Translation: CAJ18453.1
BC012719 mRNA Translation: AAH12719.1 Different initiation.
BC024652 mRNA Translation: AAH24652.1
BC108418 mRNA Translation: AAI08419.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS19927.1 [Q99M96-8]
CCDS39431.1 [Q99M96-9]
CCDS71728.1 [Q99M96-1]
CCDS71729.1 [Q99M96-3]
CCDS71730.1 [Q99M96-6]
CCDS71731.1 [Q99M96-7]
CCDS80490.1 [Q99M96-2]

NCBI Reference Sequences

More...
RefSeqi
NP_001076784.1, NM_001083315.2 [Q99M96-9]
NP_001276553.1, NM_001289624.1 [Q99M96-1]
NP_001276554.1, NM_001289625.1 [Q99M96-2]
NP_001276556.1, NM_001289627.1 [Q99M96-6]
NP_001276558.1, NM_001289629.1 [Q99M96-7]
NP_071727.2, NM_022332.3 [Q99M96-8]
XP_011239376.1, XM_011241074.1

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSMUST00000000674; ENSMUSP00000000674; ENSMUSG00000029534 [Q99M96-7]
ENSMUST00000052113; ENSMUSP00000062886; ENSMUSG00000029534 [Q99M96-3]
ENSMUST00000053148; ENSMUSP00000057326; ENSMUSG00000029534 [Q99M96-8]
ENSMUST00000077080; ENSMUSP00000076334; ENSMUSG00000029534 [Q99M96-6]
ENSMUST00000081635; ENSMUSP00000080341; ENSMUSG00000029534 [Q99M96-1]
ENSMUST00000115417; ENSMUSP00000111077; ENSMUSG00000029534 [Q99M96-9]
ENSMUST00000115419; ENSMUSP00000111079; ENSMUSG00000029534 [Q99M96-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
64213

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
mmu:64213

UCSC genome browser

More...
UCSCi
uc009azu.2 mouse [Q99M96-2]
uc009azv.2 mouse [Q99M96-1]
uc009azx.2 mouse [Q99M96-7]
uc009azy.2 mouse [Q99M96-6]
uc009bac.2 mouse [Q99M96-8]
uc009bae.2 mouse [Q99M96-9]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF234885 mRNA Translation: AAF85948.1
AF234884 mRNA Translation: AAF85947.1
AY007792 mRNA Translation: AAG24458.1
AY007794 mRNA Translation: AAG24460.1
AY007795 mRNA Translation: AAG24461.1
AY007796 mRNA Translation: AAG24462.1
AY007797 mRNA Translation: AAG24463.1
AY007798 mRNA Translation: AAG24464.1
AY007799 mRNA Translation: AAG24465.1
AY551821 mRNA Translation: AAS59839.1
AY551822 mRNA Translation: AAS59840.1
AK132103 mRNA Translation: BAE20983.1
AK151550 mRNA Translation: BAE30495.1
CT010245 mRNA Translation: CAJ18453.1
BC012719 mRNA Translation: AAH12719.1 Different initiation.
BC024652 mRNA Translation: AAH24652.1
BC108418 mRNA Translation: AAI08419.1
CCDSiCCDS19927.1 [Q99M96-8]
CCDS39431.1 [Q99M96-9]
CCDS71728.1 [Q99M96-1]
CCDS71729.1 [Q99M96-3]
CCDS71730.1 [Q99M96-6]
CCDS71731.1 [Q99M96-7]
CCDS80490.1 [Q99M96-2]
RefSeqiNP_001076784.1, NM_001083315.2 [Q99M96-9]
NP_001276553.1, NM_001289624.1 [Q99M96-1]
NP_001276554.1, NM_001289625.1 [Q99M96-2]
NP_001276556.1, NM_001289627.1 [Q99M96-6]
NP_001276558.1, NM_001289629.1 [Q99M96-7]
NP_071727.2, NM_022332.3 [Q99M96-8]
XP_011239376.1, XM_011241074.1

3D structure databases

SMRiQ99M96
ModBaseiSearch...

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000057326

PTM databases

iPTMnetiQ99M96
PhosphoSitePlusiQ99M96

Proteomic databases

PaxDbiQ99M96
PRIDEiQ99M96

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
31620 125 antibodies

Genome annotation databases

EnsembliENSMUST00000000674; ENSMUSP00000000674; ENSMUSG00000029534 [Q99M96-7]
ENSMUST00000052113; ENSMUSP00000062886; ENSMUSG00000029534 [Q99M96-3]
ENSMUST00000053148; ENSMUSP00000057326; ENSMUSG00000029534 [Q99M96-8]
ENSMUST00000077080; ENSMUSP00000076334; ENSMUSG00000029534 [Q99M96-6]
ENSMUST00000081635; ENSMUSP00000080341; ENSMUSG00000029534 [Q99M96-1]
ENSMUST00000115417; ENSMUSP00000111077; ENSMUSG00000029534 [Q99M96-9]
ENSMUST00000115419; ENSMUSP00000111079; ENSMUSG00000029534 [Q99M96-2]
GeneIDi64213
KEGGimmu:64213
UCSCiuc009azu.2 mouse [Q99M96-2]
uc009azv.2 mouse [Q99M96-1]
uc009azx.2 mouse [Q99M96-7]
uc009azy.2 mouse [Q99M96-6]
uc009bac.2 mouse [Q99M96-8]
uc009bae.2 mouse [Q99M96-9]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
7982
MGIiMGI:1927450 St7

Phylogenomic databases

eggNOGiKOG3807 Eukaryota
ENOG410XQ2Z LUCA
GeneTreeiENSGT00390000000873
HOGENOMiCLU_035578_2_0_1
InParanoidiQ99M96
OMAiWATNKEP
OrthoDBi540550at2759
PhylomeDBiQ99M96
TreeFamiTF314162

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
St7 mouse

Protein Ontology

More...
PROi
PR:Q99M96
RNActiQ99M96 protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSMUSG00000029534 Expressed in ear and 238 other tissues
ExpressionAtlasiQ99M96 baseline and differential
GenevisibleiQ99M96 MM

Family and domain databases

CDDicd11557 ST7, 1 hit
Gene3Di1.25.40.10, 1 hit
InterProiView protein in InterPro
IPR007311 ST7
IPR011990 TPR-like_helical_dom_sf
PANTHERiPTHR12745 PTHR12745, 1 hit
PfamiView protein in Pfam
PF04184 ST7, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiST7_MOUSE
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q99M96
Secondary accession number(s): Q3UA20
, Q6Q9W2, Q6Q9W3, Q8R3T3, Q921F6, Q99M89, Q99M90, Q99M91, Q99M92, Q99M93, Q99M94, Q9JID7, Q9JID8
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: June 10, 2008
Last sequence update: June 1, 2001
Last modified: April 22, 2020
This is version 121 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again