Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Heat shock 70 kDa protein 14

Gene

Hspa14

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Component of the ribosome-associated complex (RAC), a complex involved in folding or maintaining nascent polypeptides in a folding-competent state. In the RAC complex, binds to the nascent polypeptide chain, while DNAJC2 stimulates its ATPase activity (By similarity).By similarity

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionChaperone
LigandATP-binding, Nucleotide-binding

Enzyme and pathway databases

ReactomeiR-MMU-3371453 Regulation of HSF1-mediated heat shock response

Names & Taxonomyi

Protein namesi
Recommended name:
Heat shock 70 kDa protein 14
Alternative name(s):
NST-1
hsr.1
Gene namesi
Name:Hspa14
Synonyms:Hsp70-4
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 2

Organism-specific databases

MGIiMGI:1354164 Hspa14

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002899471 – 509Heat shock 70 kDa protein 14Add BLAST509

Proteomic databases

EPDiQ99M31
PaxDbiQ99M31
PeptideAtlasiQ99M31
PRIDEiQ99M31

PTM databases

iPTMnetiQ99M31
PhosphoSitePlusiQ99M31

Expressioni

Gene expression databases

BgeeiENSMUSG00000051396 Expressed in 288 organ(s), highest expression level in embryo
CleanExiMM_HSPA14
GenevisibleiQ99M31 MM

Interactioni

Subunit structurei

Component of ribosome-associated complex (RAC), a heterodimer composed of Hsp70/DnaK-type chaperone HSPA14 and Hsp40/DnaJ-type chaperone DNAJC2.By similarity

GO - Molecular functioni

Protein-protein interaction databases

BioGridi206043, 8 interactors
IntActiQ99M31, 8 interactors
STRINGi10090.ENSMUSP00000027961

Structurei

3D structure databases

ProteinModelPortaliQ99M31
SMRiQ99M31
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the heat shock protein 70 family.Curated

Phylogenomic databases

eggNOGiKOG0101 Eukaryota
COG0443 LUCA
GeneTreeiENSGT00930000150862
HOGENOMiHOG000228135
HOVERGENiHBG099873
InParanoidiQ99M31
OMAiRKYKLDP
OrthoDBiEOG091G06RS
PhylomeDBiQ99M31
TreeFamiTF105045

Family and domain databases

Gene3Di2.60.34.10, 1 hit
InterProiView protein in InterPro
IPR018181 Heat_shock_70_CS
IPR029047 HSP70_peptide-bd_sf
IPR013126 Hsp_70_fam
PANTHERiPTHR19375 PTHR19375, 1 hit
PfamiView protein in Pfam
PF00012 HSP70, 1 hit
PRINTSiPR00301 HEATSHOCK70
SUPFAMiSSF100920 SSF100920, 1 hit
PROSITEiView protein in PROSITE
PS01036 HSP70_3, 1 hit

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: Q99M31-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAAIGVHLGC TSACVAVYKD GRADVVANDA GDRVTPAIVA YSEREQVVGL
60 70 80 90 100
AAKQSRIRHV SSTVVKVKQI LGRSSADPQA QKYISESKCL VIEKNGKLRY
110 120 130 140 150
EIDTGEETKL VNPEDVARLI FSKMKETAHS VLGSDANDVV VTVPFDFGEK
160 170 180 190 200
QKSALGEAAG AAGFNVLRLI HEPSAALLAY GIGQDHPTGK SNVLVFKLGG
210 220 230 240 250
TSLSLSVMEV NSGMYRVLST NTSDNIGGAH FTDTLAQYLA SEFQRLFKHD
260 270 280 290 300
VRGNARAMMK LMNSAEVAKH SLSTLGSANC FVDSLYEGQD FDCNVSRARF
310 320 330 340 350
ELLCSPLFNK CTEAIRELLR QTGFTADDIN KVVLCGGSSR IPKLQQLIKD
360 370 380 390 400
LFPAVDLLNS IPPDEVIPIG AAIEAGILVG KESTSGDDSV MIECSAKDIL
410 420 430 440 450
VKGVDESGAD RFTVLFPSGT PLPARRQHTL QAPGRVSSVC LELYESEGKN
460 470 480 490 500
SAKEEAKFAQ VVLQDLDKKE NGLRDILAVL TMKRDGSLQV TCTDQDTGKC

EAITVEVAS
Length:509
Mass (Da):54,650
Last modified:May 29, 2007 - v2
Checksum:iD27133C677373DB0
GO
Isoform 2 (identifier: Q99M31-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     485-509: DGSLQVTCTDQDTGKCEAITVEVAS → YKMKCFQYYEDSLKLGPFGAWLNYHSRQILC

Note: No experimental confirmation available.
Show »
Length:515
Mass (Da):55,883
Checksum:iA8671B288E6A9C23
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti229A → G in AAA17724 (Ref. 1) Curated1
Sequence conflicti237Q → R in AAH02056 (PubMed:19468303).Curated1
Sequence conflicti335C → WHE in AAA17724 (Ref. 1) Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_026032485 – 509DGSLQ…VEVAS → YKMKCFQYYEDSLKLGPFGA WLNYHSRQILC in isoform 2. CuratedAdd BLAST25

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U08215 mRNA Translation: AAA17724.1
AK145937 mRNA Translation: BAE26767.1
AK153397 mRNA Translation: BAE31959.1
AL732620 Genomic DNA No translation available.
BC002056 mRNA Translation: AAH02056.1
CCDSiCCDS15653.1 [Q99M31-1]
RefSeqiNP_056580.2, NM_015765.2 [Q99M31-1]
UniGeneiMm.89341

Genome annotation databases

EnsembliENSMUST00000027961; ENSMUSP00000027961; ENSMUSG00000109865 [Q99M31-1]
GeneIDi50497
KEGGimmu:50497
UCSCiuc008ief.1 mouse [Q99M31-1]
uc008ieg.1 mouse [Q99M31-2]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U08215 mRNA Translation: AAA17724.1
AK145937 mRNA Translation: BAE26767.1
AK153397 mRNA Translation: BAE31959.1
AL732620 Genomic DNA No translation available.
BC002056 mRNA Translation: AAH02056.1
CCDSiCCDS15653.1 [Q99M31-1]
RefSeqiNP_056580.2, NM_015765.2 [Q99M31-1]
UniGeneiMm.89341

3D structure databases

ProteinModelPortaliQ99M31
SMRiQ99M31
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi206043, 8 interactors
IntActiQ99M31, 8 interactors
STRINGi10090.ENSMUSP00000027961

PTM databases

iPTMnetiQ99M31
PhosphoSitePlusiQ99M31

Proteomic databases

EPDiQ99M31
PaxDbiQ99M31
PeptideAtlasiQ99M31
PRIDEiQ99M31

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000027961; ENSMUSP00000027961; ENSMUSG00000109865 [Q99M31-1]
GeneIDi50497
KEGGimmu:50497
UCSCiuc008ief.1 mouse [Q99M31-1]
uc008ieg.1 mouse [Q99M31-2]

Organism-specific databases

CTDi51182
MGIiMGI:1354164 Hspa14

Phylogenomic databases

eggNOGiKOG0101 Eukaryota
COG0443 LUCA
GeneTreeiENSGT00930000150862
HOGENOMiHOG000228135
HOVERGENiHBG099873
InParanoidiQ99M31
OMAiRKYKLDP
OrthoDBiEOG091G06RS
PhylomeDBiQ99M31
TreeFamiTF105045

Enzyme and pathway databases

ReactomeiR-MMU-3371453 Regulation of HSF1-mediated heat shock response

Miscellaneous databases

PROiPR:Q99M31
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000051396 Expressed in 288 organ(s), highest expression level in embryo
CleanExiMM_HSPA14
GenevisibleiQ99M31 MM

Family and domain databases

Gene3Di2.60.34.10, 1 hit
InterProiView protein in InterPro
IPR018181 Heat_shock_70_CS
IPR029047 HSP70_peptide-bd_sf
IPR013126 Hsp_70_fam
PANTHERiPTHR19375 PTHR19375, 1 hit
PfamiView protein in Pfam
PF00012 HSP70, 1 hit
PRINTSiPR00301 HEATSHOCK70
SUPFAMiSSF100920 SSF100920, 1 hit
PROSITEiView protein in PROSITE
PS01036 HSP70_3, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiHSP7E_MOUSE
AccessioniPrimary (citable) accession number: Q99M31
Secondary accession number(s): A2AJH7, Q3U5W7, Q60637
Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 29, 2007
Last sequence update: May 29, 2007
Last modified: November 7, 2018
This is version 128 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again