Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 145 (29 Sep 2021)
Sequence version 2 (29 May 2007)
Previous versions | rss
Add a publicationFeedback
Protein

Heat shock 70 kDa protein 14

Gene

Hspa14

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:4 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Component of the ribosome-associated complex (RAC), a complex involved in folding or maintaining nascent polypeptides in a folding-competent state. In the RAC complex, binds to the nascent polypeptide chain, while DNAJC2 stimulates its ATPase activity (By similarity).

By similarity

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionChaperone
LigandATP-binding, Nucleotide-binding

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-MMU-3371453, Regulation of HSF1-mediated heat shock response

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Heat shock 70 kDa protein 14
Alternative name(s):
NST-1
hsr.1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Hspa14
Synonyms:Hsp70-4
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 2

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:1354164, Hspa14

Eukaryotic Pathogen, Vector and Host Database Resources

More...
VEuPathDBi
HostDB:ENSMUSG00000109865

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Keywords - Cellular componenti

Cytoplasm

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002899471 – 509Heat shock 70 kDa protein 14Add BLAST509

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q99M31

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q99M31

PeptideAtlas

More...
PeptideAtlasi
Q99M31

PRoteomics IDEntifications database

More...
PRIDEi
Q99M31

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
267068 [Q99M31-1]
267069 [Q99M31-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q99M31

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q99M31

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSMUSG00000051396, Expressed in embryo and 311 other tissues

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q99M31, MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Component of ribosome-associated complex (RAC), a heterodimer composed of Hsp70/DnaK-type chaperone HSPA14 and Hsp40/DnaJ-type chaperone DNAJC2.

By similarity

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
206043, 8 interactors

Protein interaction database and analysis system

More...
IntActi
Q99M31, 10 interactors

Molecular INTeraction database

More...
MINTi
Q99M31

STRING: functional protein association networks

More...
STRINGi
10090.ENSMUSP00000027961

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q99M31, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q99M31

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the heat shock protein 70 family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG0101, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000156380

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_005965_0_3_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q99M31

Identification of Orthologs from Complete Genome Data

More...
OMAi
ITIECSA

Database of Orthologous Groups

More...
OrthoDBi
646813at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q99M31

TreeFam database of animal gene trees

More...
TreeFami
TF105045

Family and domain databases

Conserved Domains Database

More...
CDDi
cd10238, HSPA14-like_NBD, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
2.60.34.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR043129, ATPase_NBD
IPR018181, Heat_shock_70_CS
IPR029047, HSP70_peptide-bd_sf
IPR013126, Hsp_70_fam
IPR042049, HSPA14_NBD

The PANTHER Classification System

More...
PANTHERi
PTHR19375, PTHR19375, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00012, HSP70, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF100920, SSF100920, 1 hit
SSF53067, SSF53067, 2 hits

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS01036, HSP70_3, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: Q99M31-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAAIGVHLGC TSACVAVYKD GRADVVANDA GDRVTPAIVA YSEREQVVGL
60 70 80 90 100
AAKQSRIRHV SSTVVKVKQI LGRSSADPQA QKYISESKCL VIEKNGKLRY
110 120 130 140 150
EIDTGEETKL VNPEDVARLI FSKMKETAHS VLGSDANDVV VTVPFDFGEK
160 170 180 190 200
QKSALGEAAG AAGFNVLRLI HEPSAALLAY GIGQDHPTGK SNVLVFKLGG
210 220 230 240 250
TSLSLSVMEV NSGMYRVLST NTSDNIGGAH FTDTLAQYLA SEFQRLFKHD
260 270 280 290 300
VRGNARAMMK LMNSAEVAKH SLSTLGSANC FVDSLYEGQD FDCNVSRARF
310 320 330 340 350
ELLCSPLFNK CTEAIRELLR QTGFTADDIN KVVLCGGSSR IPKLQQLIKD
360 370 380 390 400
LFPAVDLLNS IPPDEVIPIG AAIEAGILVG KESTSGDDSV MIECSAKDIL
410 420 430 440 450
VKGVDESGAD RFTVLFPSGT PLPARRQHTL QAPGRVSSVC LELYESEGKN
460 470 480 490 500
SAKEEAKFAQ VVLQDLDKKE NGLRDILAVL TMKRDGSLQV TCTDQDTGKC

EAITVEVAS
Length:509
Mass (Da):54,650
Last modified:May 29, 2007 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iD27133C677373DB0
GO
Isoform 2 (identifier: Q99M31-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     485-509: DGSLQVTCTDQDTGKCEAITVEVAS → YKMKCFQYYEDSLKLGPFGAWLNYHSRQILC

Show »
Length:515
Mass (Da):55,883
Checksum:iA8671B288E6A9C23
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti229A → G in AAA17724 (Ref. 1) Curated1
Sequence conflicti237Q → R in AAH02056 (PubMed:19468303).Curated1
Sequence conflicti335C → WHE in AAA17724 (Ref. 1) Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_026032485 – 509DGSLQ…VEVAS → YKMKCFQYYEDSLKLGPFGA WLNYHSRQILC in isoform 2. CuratedAdd BLAST25

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
U08215 mRNA Translation: AAA17724.1
AK145937 mRNA Translation: BAE26767.1
AK153397 mRNA Translation: BAE31959.1
AL732620 Genomic DNA No translation available.
BC002056 mRNA Translation: AAH02056.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS15653.1 [Q99M31-1]

NCBI Reference Sequences

More...
RefSeqi
NP_056580.2, NM_015765.2 [Q99M31-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSMUST00000027961; ENSMUSP00000027961; ENSMUSG00000109865 [Q99M31-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
50497

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
mmu:50497

UCSC genome browser

More...
UCSCi
uc008ief.1, mouse [Q99M31-1]
uc008ieg.1, mouse [Q99M31-2]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U08215 mRNA Translation: AAA17724.1
AK145937 mRNA Translation: BAE26767.1
AK153397 mRNA Translation: BAE31959.1
AL732620 Genomic DNA No translation available.
BC002056 mRNA Translation: AAH02056.1
CCDSiCCDS15653.1 [Q99M31-1]
RefSeqiNP_056580.2, NM_015765.2 [Q99M31-1]

3D structure databases

SMRiQ99M31
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi206043, 8 interactors
IntActiQ99M31, 10 interactors
MINTiQ99M31
STRINGi10090.ENSMUSP00000027961

PTM databases

iPTMnetiQ99M31
PhosphoSitePlusiQ99M31

Proteomic databases

EPDiQ99M31
PaxDbiQ99M31
PeptideAtlasiQ99M31
PRIDEiQ99M31
ProteomicsDBi267068 [Q99M31-1]
267069 [Q99M31-2]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
37843, 146 antibodies

The DNASU plasmid repository

More...
DNASUi
50497

Genome annotation databases

EnsembliENSMUST00000027961; ENSMUSP00000027961; ENSMUSG00000109865 [Q99M31-1]
GeneIDi50497
KEGGimmu:50497
UCSCiuc008ief.1, mouse [Q99M31-1]
uc008ieg.1, mouse [Q99M31-2]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
51182
MGIiMGI:1354164, Hspa14
VEuPathDBiHostDB:ENSMUSG00000109865

Phylogenomic databases

eggNOGiKOG0101, Eukaryota
GeneTreeiENSGT00940000156380
HOGENOMiCLU_005965_0_3_1
InParanoidiQ99M31
OMAiITIECSA
OrthoDBi646813at2759
PhylomeDBiQ99M31
TreeFamiTF105045

Enzyme and pathway databases

ReactomeiR-MMU-3371453, Regulation of HSF1-mediated heat shock response

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
50497, 18 hits in 64 CRISPR screens

Protein Ontology

More...
PROi
PR:Q99M31
RNActiQ99M31, protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSMUSG00000051396, Expressed in embryo and 311 other tissues
GenevisibleiQ99M31, MM

Family and domain databases

CDDicd10238, HSPA14-like_NBD, 1 hit
Gene3Di2.60.34.10, 1 hit
InterProiView protein in InterPro
IPR043129, ATPase_NBD
IPR018181, Heat_shock_70_CS
IPR029047, HSP70_peptide-bd_sf
IPR013126, Hsp_70_fam
IPR042049, HSPA14_NBD
PANTHERiPTHR19375, PTHR19375, 1 hit
PfamiView protein in Pfam
PF00012, HSP70, 1 hit
SUPFAMiSSF100920, SSF100920, 1 hit
SSF53067, SSF53067, 2 hits
PROSITEiView protein in PROSITE
PS01036, HSP70_3, 1 hit

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiHSP7E_MOUSE
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q99M31
Secondary accession number(s): A2AJH7, Q3U5W7, Q60637
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 29, 2007
Last sequence update: May 29, 2007
Last modified: September 29, 2021
This is version 145 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again