UniProtKB - Q99LJ5 (CKLF3_MOUSE)

BLAST

>sp|Q99LJ5|CKLF3_MOUSE CKLF-like MARVEL transmembrane domain-containing protein 3 OS=Mus musculus OX=10090 GN=Cmtm3 PE=2 SV=1
MWPPDAEPEPDPESAHGPRSGRTVPGLRALLPARAFLCSLKGRLLLAESGLSFITFICYV
VSSASAFLTVPLLEFLLAVYFLFADAMQLNDKWQGLCWPMMDFLRCVTAALIYFVISITA
VAKYSDGAYKAAGVFGFFATIVFAIDFYLIFNEVAKFLKQGDSGNETTAHRTEEENSNSD
SDSD

Align
Format
Add to basket Added to basket
History
Entry version 110 (07 Nov 2018)
Sequence version 1 (01 Jun 2001)
Previous versions | rss
Other tutorials and videos
Help video
Feedback

Protein

CKLF-like MARVEL transmembrane domain-containing protein 3

Gene

Cmtm3

Organism

Mus musculus (Mouse)

Status

Reviewed-Annotation score: -Experimental evidence at transcript levelⁱ

Functionⁱ

GO - Molecular functionⁱ

cytokine activity Source: UniProtKB-KW

View the complete GO annotation on QuickGO ...

GO - Biological processⁱ

blastocyst hatching
Source: MGI
Inferred from mutant phenotypeⁱ
- 27869233
chemotaxis Source: UniProtKB-KW
positive regulation of B cell receptor signaling pathway
Source: MGI
Inferred from direct assayⁱ
- 15196959

View the complete GO annotation on QuickGO ...

Keywordsⁱ

Molecular function	Cytokine
Biological process	Chemotaxis

Names & Taxonomyⁱ

Protein namesⁱ	Recommended name: CKLF-like MARVEL transmembrane domain-containing protein 3 Alternative name(s): Chemokine-like factor superfamily member 3
Gene namesⁱ	Name:Cmtm3 Synonyms:Cklfsf3
Organismⁱ	Mus musculus (Mouse)
Taxonomic identifierⁱ	10090 [NCBI]
Taxonomic lineageⁱ	cellular organisms › Eukaryota › Opisthokonta › Metazoa › Eumetazoa › Bilateria › Deuterostomia › Chordata › Craniata › Vertebrata › Gnathostomata › Teleostomi › Euteleostomi › Sarcopterygii › Dipnotetrapodomorpha › Tetrapoda › Amniota › Mammalia › Theria › Eutheria › Boreoeutheria › Euarchontoglires › Glires › Rodentia › Myomorpha › Muroidea › Muridae › Murinae › Mus › Mus
Proteomesⁱ	UP000000589 Componentⁱ: Chromosome 8

Organism-specific databases

MGIⁱ	MGI:2447162 Cmtm3

Topology

Feature key	Position(s)	DescriptionActions	Length
Transmembraneⁱ	64 – 84	HelicalSequence analysisAdd BLAST	21
Transmembraneⁱ	96 – 116	HelicalSequence analysisAdd BLAST	21
Transmembraneⁱ	131 – 151	HelicalSequence analysisAdd BLAST	21

Keywords - Cellular componentⁱ

Membrane

PTM / Processingⁱ

Molecule processing

Feature key	Position(s)	DescriptionActions	Graphical view	Length
ChainⁱPRO_0000186102	1 – 184	CKLF-like MARVEL transmembrane domain-containing protein 3Add BLAST		184

Proteomic databases

MaxQB - The MaxQuant DataBase More...MaxQBⁱ	Q99LJ5
PaxDbⁱ	Q99LJ5
PRIDEⁱ	Q99LJ5

PTM databases

iPTMnetⁱ	Q99LJ5
PhosphoSitePlusⁱ	Q99LJ5
SwissPalmⁱ	Q99LJ5

Expressionⁱ

Gene expression databases

Bgeeⁱ	ENSMUSG00000031875 Expressed in 251 organ(s), highest expression level in decidua
ExpressionAtlasⁱ	Q99LJ5 baseline and differential
Genevisibleⁱ	Q99LJ5 MM

Interactionⁱ

GO - Molecular functionⁱ

cytokine activity Source: UniProtKB-KW

View the complete GO annotation on QuickGO ...

Protein-protein interaction databases

BioGridⁱ	212666, 1 interactor
CORUMⁱ	Q99LJ5
STRINGⁱ	10090.ENSMUSP00000034343

Family & Domainsⁱ

Domains and Repeats

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Domainⁱ	36 – 155	MARVELPROSITE-ProRule annotationAdd BLAST		120

Sequence similaritiesⁱ

Belongs to the chemokine-like factor family.Curated

Keywords - Domainⁱ

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGⁱ	KOG4788 Eukaryota ENOG4111IAF LUCA
Ensembl GeneTree More...GeneTreeⁱ	ENSGT00530000063326
HOGENOMⁱ	HOG000290654
HOVERGENⁱ	HBG053619
InParanoidⁱ	Q99LJ5
Database of Orthologous Groups More...OrthoDBⁱ	EOG091G11FO
PhylomeDBⁱ	Q99LJ5
TreeFamⁱ	TF317387

Family and domain databases

InterProⁱ	View protein in InterPro IPR008253 Marvel
Pfam protein domain database More...Pfamⁱ	View protein in Pfam PF01284 MARVEL, 1 hit
PROSITEⁱ	View protein in PROSITE PS51225 MARVEL, 1 hit

Sequence (1+)ⁱ

Sequence statusⁱ: Complete.

This entry has 1 described isoform and 3 potential isoforms that are computationally mapped.Show all Align All

Q99LJ5-1 [UniParc]FASTA Add to basket

« Hide

        10         20         30         40         50
MWPPDAEPEP DPESAHGPRS GRTVPGLRAL LPARAFLCSL KGRLLLAESG 
        60         70         80         90        100
LSFITFICYV VSSASAFLTV PLLEFLLAVY FLFADAMQLN DKWQGLCWPM 
       110        120        130        140        150
MDFLRCVTAA LIYFVISITA VAKYSDGAYK AAGVFGFFAT IVFAIDFYLI 
       160        170        180 
FNEVAKFLKQ GDSGNETTAH RTEEENSNSD SDSD

Length:184

Mass (Da):20,247

Last modified:June 1, 2001 - v1

Checksum:ⁱ6FBB899137D51EB3

Computationally mapped potential isoform sequencesⁱ

There are 3 potential isoforms mapped to this entry.BLAST Align Show all Add to basket

Entry	Entry name	Protein names	Gene names	Length	Annotation

A0A1D5RM50	A0A1D5RM50_MOUSE	CKLF-like MARVEL transmembrane doma... CKLF-like MARVEL transmembrane domain-containing protein 3	Cmtm3	142	Annotation score:
A0A1D5RLE8	A0A1D5RLE8_MOUSE	CKLF-like MARVEL transmembrane doma... CKLF-like MARVEL transmembrane domain-containing protein 3	Cmtm3	118	Annotation score:
A0A1D5RLU9	A0A1D5RLU9_MOUSE	CKLF-like MARVEL transmembrane doma... CKLF-like MARVEL transmembrane domain-containing protein 3	Cmtm3	82	Annotation score:

Sequence cautionⁱ

The sequence BAB23056 differs from that shown. Reason: Frameshift at position 137.Curated

Experimental Info

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Sequence conflictⁱ	146	D → G in BAC37565 (PubMed:16141072).Curated		1

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	AY241870 mRNA Translation: AAP33492.1 AK003882 mRNA Translation: BAB23056.1 Frameshift. AK079165 mRNA Translation: BAC37565.1 BC003230 mRNA Translation: AAH03230.1 BC145817 mRNA Translation: AAI45818.1 BC145819 mRNA Translation: AAI45820.1
The Consensus CDS (CCDS) project More...CCDSⁱ	CCDS22577.1
NCBI Reference Sequences More...RefSeqⁱ	NP_077179.1, NM_024217.3 XP_006531389.1, XM_006531326.1 XP_006531390.1, XM_006531327.2 XP_006531391.1, XM_006531328.1 XP_006531392.1, XM_006531329.2
UniGeneⁱ	Mm.390108

Genome annotation databases

Ensemblⁱ	ENSMUST00000034343; ENSMUSP00000034343; ENSMUSG00000031875 ENSMUST00000212081; ENSMUSP00000148682; ENSMUSG00000031875
GeneIDⁱ	68119
KEGGⁱ	mmu:68119
UCSC genome browser More...UCSCⁱ	uc009nam.1 mouse

Similar proteinsⁱ

100% Identity
90% Identity
50% Identity

Protein	Similar proteins		Species	Score	Length	Source
Q99LJ5	CKLF-like MARVEL transmembrane domain-containing protein 3 (Fragment)		MOUSE		142	UniRef100_Q99LJ5
CKLF-like MARVEL transmembrane domain-containing protein 3 (Fragment)		MOUSE		82
CKLF-like MARVEL transmembrane domain-containing protein 3 (Fragment)		MOUSE		118

Protein	Similar proteins		Species	Score	Length	Source
Q99LJ5	CKLF-like MARVEL transmembrane domain-containing protein 3 (Fragment)		MOUSE		142	UniRef90_Q99LJ5
CKLF-like MARVEL transmembrane domain-containing protein 3		MESAU		185
Uncharacterized protein		NEOLE		185
CKLF-like MARVEL transmembrane domain containing 3 (Predicted)		RAT		184
CKLF-like MARVEL transmembrane domain-containing protein 3		CRIGR		184
+9

Protein	Similar proteins		Species	Score	Length	Source
Q99LJ5	CKLF-like MARVEL transmembrane domain-containing protein 3 (Fragment)		MOUSE		142	UniRef50_Q99LJ5
Uncharacterized protein		NEOLE		185
CKLF-like MARVEL transmembrane domain-containing protein 3		MESAU		185
CKLF-like MARVEL transmembrane domain-containing protein 3		CRIGR		184
CKLF-like MARVEL transmembrane domain containing 3 (Predicted)		RAT		184
+104

Cross-referencesⁱ

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	AY241870 mRNA Translation: AAP33492.1 AK003882 mRNA Translation: BAB23056.1 Frameshift. AK079165 mRNA Translation: BAC37565.1 BC003230 mRNA Translation: AAH03230.1 BC145817 mRNA Translation: AAI45818.1 BC145819 mRNA Translation: AAI45820.1
CCDSⁱ	CCDS22577.1
RefSeqⁱ	NP_077179.1, NM_024217.3 XP_006531389.1, XM_006531326.1 XP_006531390.1, XM_006531327.2 XP_006531391.1, XM_006531328.1 XP_006531392.1, XM_006531329.2
UniGeneⁱ	Mm.390108

3D structure databases

ModBaseⁱ	Search...
MobiDBⁱ	Search...

Protein-protein interaction databases

BioGridⁱ	212666, 1 interactor
CORUMⁱ	Q99LJ5
STRINGⁱ	10090.ENSMUSP00000034343

PTM databases

iPTMnetⁱ	Q99LJ5
PhosphoSitePlusⁱ	Q99LJ5
SwissPalmⁱ	Q99LJ5

Proteomic databases

MaxQBⁱ	Q99LJ5
PaxDbⁱ	Q99LJ5
PRIDEⁱ	Q99LJ5

Protocols and materials databases

Structural Biology Knowledgebase	Search...

Structural Biology Knowledgebase

Search...

Genome annotation databases

Ensemblⁱ	ENSMUST00000034343; ENSMUSP00000034343; ENSMUSG00000031875 ENSMUST00000212081; ENSMUSP00000148682; ENSMUSG00000031875
GeneIDⁱ	68119
KEGGⁱ	mmu:68119
UCSCⁱ	uc009nam.1 mouse

Organism-specific databases

CTDⁱ	123920
MGIⁱ	MGI:2447162 Cmtm3

Phylogenomic databases

eggNOGⁱ	KOG4788 Eukaryota ENOG4111IAF LUCA
GeneTreeⁱ	ENSGT00530000063326
HOGENOMⁱ	HOG000290654
HOVERGENⁱ	HBG053619
InParanoidⁱ	Q99LJ5
OrthoDBⁱ	EOG091G11FO
PhylomeDBⁱ	Q99LJ5
TreeFamⁱ	TF317387

Miscellaneous databases

Protein Ontology More...PROⁱ	PR:Q99LJ5
SOURCEⁱ	Search...

Gene expression databases

Bgeeⁱ	ENSMUSG00000031875 Expressed in 251 organ(s), highest expression level in decidua
ExpressionAtlasⁱ	Q99LJ5 baseline and differential
Genevisibleⁱ	Q99LJ5 MM

Family and domain databases

InterProⁱ	View protein in InterPro IPR008253 Marvel
Pfamⁱ	View protein in Pfam PF01284 MARVEL, 1 hit
PROSITEⁱ	View protein in PROSITE PS51225 MARVEL, 1 hit
ProtoNetⁱ	Search...

Entry informationⁱ

Entry nameⁱ	CKLF3_MOUSE
Accessionⁱ	Q99LJ5Primary (citable) accession number: Q99LJ5 Secondary accession number(s): A6H6B5, Q8BJU1, Q9D165
Entry historyⁱ	Integrated into UniProtKB/Swiss-Prot:	September 19, 2003
	Last sequence update:	June 1, 2001
	Last modified:	November 7, 2018
	This is version 110 of the entry and version 1 of the sequence. See complete history.
Entry statusⁱ	Reviewed (UniProtKB/Swiss-Prot)
Annotation program	Chordata Protein Annotation Program

Miscellaneousⁱ

Keywords - Technical termⁱ

Complete proteome, Reference proteome

Documents

SIMILARITY comments
Index of protein domains and families
MGD cross-references
Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot

UniProtKB

UniParc

Help

UniRef

Proteomes

Annotation systems

Supporting data

UniProtKB - Q99LJ5 (CKLF3_MOUSE)

Your basket is currently empty. i <p>When browsing through different UniProt proteins, you can use the ‘basket’ to save them, so that you can back to find or analyse them later.<p><a href='/help/basket' target='_top'>More...</a></p>

CKLF-like MARVEL transmembrane domain-containing protein 3

Cmtm3

Select a section on the left to see content.

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

Organism-specific databases

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Other locations

Extracellular region or secreted

Nucleus

Other locations

Topology

Keywords - Cellular componenti

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Proteomic databases

PTM databases

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

GO - Molecular functioni

Protein-protein interaction databases

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Keywords - Domaini

Phylogenomic databases

Family and domain databases

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

Experimental Info

Sequence databases

Genome annotation databases

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

3D structure databases

Protein-protein interaction databases

PTM databases

Proteomic databases

Protocols and materials databases

Genome annotation databases

Organism-specific databases

Phylogenomic databases

Miscellaneous databases

Gene expression databases

Family and domain databases

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Documents

UniProt is an ELIXIR core data resource

Your basket is currently empty. ⁱ

Functionⁱ

GO - Molecular functionⁱ

GO - Biological processⁱ

Names & Taxonomyⁱ

Subcellular locationⁱ

Keywords - Cellular componentⁱ

PTM / Processingⁱ

Expressionⁱ

Interactionⁱ

GO - Molecular functionⁱ

Family & Domainsⁱ

Sequence similaritiesⁱ

Keywords - Domainⁱ

Sequence cautionⁱ

Cross-referencesⁱ

Entry informationⁱ

Miscellaneousⁱ

Keywords - Technical termⁱ