Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Neuroligin-1

Gene

Nlgn1

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Cell surface protein involved in cell-cell-interactions via its interactions with neurexin family members. Plays a role in synapse function and synaptic signal transmission, and probably mediates its effects by recruiting and clustering other synaptic proteins. May promote the initial formation of synapses, but is not essential for this. In vitro, triggers the de novo formation of presynaptic structures. May be involved in specification of excitatory synapses. Required to maintain wakefulness quality and normal synchrony of cerebral cortex activity during wakefulness and sleep (PubMed:23716671).4 Publications

GO - Molecular functioni

GO - Biological processi

Keywordsi

Biological processBiological rhythms, Cell adhesion

Enzyme and pathway databases

ReactomeiR-MMU-6794361 Neurexins and neuroligins

Protein family/group databases

ESTHERimouse-1neur Neuroligin
MEROPSiS09.994

Names & Taxonomyi

Protein namesi
Recommended name:
Neuroligin-1
Gene namesi
Name:Nlgn1
Synonyms:Kiaa1070
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 3

Organism-specific databases

MGIiMGI:2179435 Nlgn1

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini46 – 697ExtracellularSequence analysisAdd BLAST652
Transmembranei698 – 718HelicalSequence analysisAdd BLAST21
Topological domaini719 – 843CytoplasmicSequence analysisAdd BLAST125

Keywords - Cellular componenti

Cell junction, Cell membrane, Membrane, Postsynaptic cell membrane, Synapse

Pathology & Biotechi

Disruption phenotypei

No obvious phenotype, but mice present subtle behavorial changes with some deficits in spatial learning and memory. In addition, mice have reduced brain volume. Mice lacking both NLGN1 and NLGN2, or NLGN1 and NLGN3, are viable, but have impaired breathing, drastically reduced reproduction rates and striking deficits in raising their offspring. Mice lacking NLGN1, NLGN2 and NLGN3 are born at the expected Mendelian rate, but die shortly after birth due to respiratory failure. They do not show a significant change in the number of synapses, but synapse function is strongly impaired. Mice exhibit social novelty and fear-conditioning deficits and also show reduced wakefulness duration and altered EEG during wakefulness and sleep.3 Publications

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 45Sequence analysisAdd BLAST45
ChainiPRO_000000864146 – 843Neuroligin-1Add BLAST798

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Glycosylationi109N-linked (GlcNAc...) (complex) asparagine1 Publication1
Disulfide bondi117 ↔ 1531 Publication
Glycosylationi303N-linked (GlcNAc...) (complex) asparagineBy similarity1
Disulfide bondi342 ↔ 3531 Publication
Glycosylationi343N-linked (GlcNAc...) (complex) asparagineBy similarity1
Disulfide bondi512 ↔ 5461 Publication
Glycosylationi547N-linked (GlcNAc...) asparagine1 Publication1
Glycosylationi683O-linked (GalNAc...) serineBy similarity1
Glycosylationi686O-linked (GalNAc...) serineBy similarity1

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

PaxDbiQ99K10
PeptideAtlasiQ99K10
PRIDEiQ99K10

PTM databases

iPTMnetiQ99K10
PhosphoSitePlusiQ99K10

Expressioni

Tissue specificityi

Brain and arteries (at protein level). Expressed in olfactory bulb. Detected in brain.4 Publications

Inductioni

Expressed in a circadian manner in the brain with highest expression seen at Zeitgeber time (ZT) 6 hours.1 Publication

Gene expression databases

BgeeiENSMUSG00000063887 Expressed in 141 organ(s), highest expression level in lumbar subsegment of spinal cord
CleanExiMM_NLGN1
ExpressionAtlasiQ99K10 baseline and differential
GenevisibleiQ99K10 MM

Interactioni

Subunit structurei

Interacts with NRXN1, NRXN2 and NRXN3. Interacts (via its C-terminus) with DLG4/PSD-95 (via PDZ domain 3). Interacts with AIP1, GOPC and PDZRN3 (By similarity). Interacts with NLGN3.By similarity2 Publications

Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

BioGridi228657, 1 interactor
DIPiDIP-32027N
IntActiQ99K10, 3 interactors
MINTiQ99K10
STRINGi10090.ENSMUSP00000074565

Structurei

Secondary structure

1843
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

ProteinModelPortaliQ99K10
SMRiQ99K10
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ99K10

Family & Domainsi

Sequence similaritiesi

Keywords - Domaini

Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG1516 Eukaryota
COG2272 LUCA
GeneTreeiENSGT00760000118946
HOGENOMiHOG000231424
HOVERGENiHBG008839
InParanoidiQ99K10
KOiK07378
OMAiANDFDYA
OrthoDBiEOG091G0CHW
PhylomeDBiQ99K10
TreeFamiTF326187

Family and domain databases

Gene3Di3.40.50.1820, 1 hit
InterProiView protein in InterPro
IPR029058 AB_hydrolase
IPR002018 CarbesteraseB
IPR019819 Carboxylesterase_B_CS
IPR000460 Nlgn
IPR030022 NLGN1
PANTHERiPTHR43903:SF2 PTHR43903:SF2, 1 hit
PfamiView protein in Pfam
PF00135 COesterase, 1 hit
PRINTSiPR01090 NEUROLIGIN
SUPFAMiSSF53474 SSF53474, 1 hit
PROSITEiView protein in PROSITE
PS00941 CARBOXYLESTERASE_B_2, 1 hit

Sequences (2+)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: Q99K10-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MALPRCMWPN YVWRAMMACV VHRGSGAPLT LCLLGCLLQT FHVLSQKLDD
60 70 80 90 100
VDPLVTTNFG KIRGIKKELN NEILGPVIQF LGVPYAAPPT GEHRFQPPEP
110 120 130 140 150
PSPWSDIRNA TQFAPVCPQN IIDGRLPEVM LPVWFTNNLD VVSSYVQDQS
160 170 180 190 200
EDCLYLNIYV PTEDGPLTKK HTDDLGDNDG AEDEDIRDSG GPKPVMVYIH
210 220 230 240 250
GGSYMEGTGN LYDGSVLASY GNVIVITVNY RLGVLGFLST GDQAAKGNYG
260 270 280 290 300
LLDLIQALRW TSENIGFFGG DPLRITVFGS GAGGSCVNLL TLSHYSEGNR
310 320 330 340 350
WSNSTKGLFQ RAIAQSGTAL SSWAVSFQPA KYARILATKV GCNVSDTVEL
360 370 380 390 400
VECLQKKPYK ELVDQDVQPA RYHIAFGPVI DGDVIPDDPQ ILMEQGEFLN
410 420 430 440 450
YDIMLGVNQG EGLKFVENIV DSDDGVSASD FDFAVSNFVD NLYGYPEGKD
460 470 480 490 500
VLRETIKFMY TDWADRHNPE TRRKTLLALF TDHQWVAPAV ATADLHSNFG
510 520 530 540 550
SPTYFYAFYH HCQTDQVPAW ADAAHGDEVP YVLGIPMIGP TELFPCNFSK
560 570 580 590 600
NDVMLSAVVM TYWTNFAKTG DPNQPVPQDT KFIHTKPNRF EEVAWTRYSQ
610 620 630 640 650
KDQLYLHIGL KPRVKEHYRA NKVNLWLELV PHLHNLNDIS QYTSTTTKVP
660 670 680 690 700
STDITLRPTR KNSTPVTSAF PTAKQDDPKQ QPSPFSVDQR DYSTELSVTI
710 720 730 740 750
AVGASLLFLN ILAFAALYYK KDKRRHDVHR RCSPQRTTTN DLTHAPEEEI
760 770 780 790 800
MSLQMKHTDL DHECESIHPH EVVLRTACPP DYTLAMRRSP DDIPLMTPNT
810 820 830 840
ITMIPNTIPG IQPLHTFNTF TGGQNNTLPH PHPHPHSHST TRV
Note: No experimental confirmation available.
Length:843
Mass (Da):94,149
Last modified:May 23, 2003 - v2
Checksum:i69E50709CF7D2E1F
GO
Isoform 2 (identifier: Q99K10-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     165-184: Missing.
     236-269: GFLSTGDQAAKGNYGLLDLIQALRWTSENIGFFG → EKETIKETISVALQALRTKGGGFIPKQATYKRCE
     270-843: Missing.

Note: No experimental confirmation available.
Show »
Length:249
Mass (Da):27,602
Checksum:i1D87ADF1EAFF2F0B
GO

Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E9QK34E9QK34_MOUSE
Neuroligin-1
Nlgn1
814Annotation score:

Sequence cautioni

The sequence BAC65715 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_007528165 – 184Missing in isoform 2. 1 PublicationAdd BLAST20
Alternative sequenceiVSP_007529236 – 269GFLST…IGFFG → EKETIKETISVALQALRTKG GGFIPKQATYKRCE in isoform 2. 1 PublicationAdd BLAST34
Alternative sequenceiVSP_007530270 – 843Missing in isoform 2. 1 PublicationAdd BLAST574

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK122433 mRNA Translation: BAC65715.1 Different initiation.
BC005523 mRNA Translation: AAH05523.1
CCDSiCCDS17268.1 [Q99K10-1]
RefSeqiNP_619607.2, NM_138666.3 [Q99K10-1]
UniGeneiMm.316080

Genome annotation databases

EnsembliENSMUST00000075054; ENSMUSP00000074565; ENSMUSG00000063887 [Q99K10-1]
ENSMUST00000193603; ENSMUSP00000142200; ENSMUSG00000063887 [Q99K10-1]
GeneIDi192167
KEGGimmu:192167
UCSCiuc008otc.1 mouse [Q99K10-1]
uc008otd.1 mouse [Q99K10-2]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK122433 mRNA Translation: BAC65715.1 Different initiation.
BC005523 mRNA Translation: AAH05523.1
CCDSiCCDS17268.1 [Q99K10-1]
RefSeqiNP_619607.2, NM_138666.3 [Q99K10-1]
UniGeneiMm.316080

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
3B3QX-ray2.40A/B46-635[»]
ProteinModelPortaliQ99K10
SMRiQ99K10
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi228657, 1 interactor
DIPiDIP-32027N
IntActiQ99K10, 3 interactors
MINTiQ99K10
STRINGi10090.ENSMUSP00000074565

Protein family/group databases

ESTHERimouse-1neur Neuroligin
MEROPSiS09.994

PTM databases

iPTMnetiQ99K10
PhosphoSitePlusiQ99K10

Proteomic databases

PaxDbiQ99K10
PeptideAtlasiQ99K10
PRIDEiQ99K10

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000075054; ENSMUSP00000074565; ENSMUSG00000063887 [Q99K10-1]
ENSMUST00000193603; ENSMUSP00000142200; ENSMUSG00000063887 [Q99K10-1]
GeneIDi192167
KEGGimmu:192167
UCSCiuc008otc.1 mouse [Q99K10-1]
uc008otd.1 mouse [Q99K10-2]

Organism-specific databases

CTDi22871
MGIiMGI:2179435 Nlgn1
RougeiSearch...

Phylogenomic databases

eggNOGiKOG1516 Eukaryota
COG2272 LUCA
GeneTreeiENSGT00760000118946
HOGENOMiHOG000231424
HOVERGENiHBG008839
InParanoidiQ99K10
KOiK07378
OMAiANDFDYA
OrthoDBiEOG091G0CHW
PhylomeDBiQ99K10
TreeFamiTF326187

Enzyme and pathway databases

ReactomeiR-MMU-6794361 Neurexins and neuroligins

Miscellaneous databases

EvolutionaryTraceiQ99K10
PROiPR:Q99K10
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000063887 Expressed in 141 organ(s), highest expression level in lumbar subsegment of spinal cord
CleanExiMM_NLGN1
ExpressionAtlasiQ99K10 baseline and differential
GenevisibleiQ99K10 MM

Family and domain databases

Gene3Di3.40.50.1820, 1 hit
InterProiView protein in InterPro
IPR029058 AB_hydrolase
IPR002018 CarbesteraseB
IPR019819 Carboxylesterase_B_CS
IPR000460 Nlgn
IPR030022 NLGN1
PANTHERiPTHR43903:SF2 PTHR43903:SF2, 1 hit
PfamiView protein in Pfam
PF00135 COesterase, 1 hit
PRINTSiPR01090 NEUROLIGIN
SUPFAMiSSF53474 SSF53474, 1 hit
PROSITEiView protein in PROSITE
PS00941 CARBOXYLESTERASE_B_2, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiNLGN1_MOUSE
AccessioniPrimary (citable) accession number: Q99K10
Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 23, 2003
Last sequence update: May 23, 2003
Last modified: November 7, 2018
This is version 152 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again