Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 169 (08 May 2019)
Sequence version 2 (25 Nov 2008)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Telomerase protein component 1

Gene

TEP1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Component of the telomerase ribonucleoprotein complex that is essential for the replication of chromosome termini (PubMed:19179534). Also component of the ribonucleoprotein vaults particle, a multi-subunit structure involved in nucleo-cytoplasmic transport (By similarity). Responsible for the localizing and stabilizing vault RNA (vRNA) association in the vault ribonucleoprotein particle. Binds to TERC (By similarity).By similarity1 Publication

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes a region in the protein which binds nucleotide phosphates. It always involves more than one amino acid and includes all residues involved in nucleotide-binding.<p><a href='/help/np_bind' target='_top'>More...</a></p>Nucleotide bindingi1168 – 1175ATPPROSITE-ProRule annotation8

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionRibonucleoprotein, RNA-binding
LigandATP-binding, Nucleotide-binding

Enzyme and pathway databases

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...
SignaLinki
Q99973

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Telomerase protein component 1
Alternative name(s):
Telomerase-associated protein 1
Short name:
Telomerase protein 1
p240
p80 telomerase homolog
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:TEP1
Synonyms:TLP1, TP1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 14

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:11726 TEP1

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
601686 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q99973

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Chromosome, Nucleus, Telomere

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
7011

Open Targets

More...
OpenTargetsi
ENSG00000129566

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA36443

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
TEP1

Domain mapping of disease mutations (DMDM)

More...
DMDMi
215273899

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000509821 – 2627Telomerase protein component 1Add BLAST2627

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q99973

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q99973

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q99973

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q99973

PeptideAtlas

More...
PeptideAtlasi
Q99973

PRoteomics IDEntifications database

More...
PRIDEi
Q99973

ProteomicsDB human proteome resource

More...
ProteomicsDBi
78559
78560 [Q99973-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q99973

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q99973

SwissPalm database of S-palmitoylation events

More...
SwissPalmi
Q99973

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Ubiquitous.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000129566 Expressed in 190 organ(s), highest expression level in intestine

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q99973 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q99973 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA029206

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Associated component of the telomerase holoenzyme complex (PubMed:19179534).

Component of the vault ribonucleoprotein particle, at least composed of MVP, PARP4 and one or more vault RNAs (vRNAs) (By similarity). Binds to VAULTRC1, VAULTRC2 and VAULTRC4/hvg4 vRNAs (By similarity).

By similarity1 Publication

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
112870, 14 interactors

Protein interaction database and analysis system

More...
IntActi
Q99973, 5 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000262715

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q99973

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section indicates the positions and types of repeated sequence motifs or repeated domains within the protein.<p><a href='/help/repeat' target='_top'>More...</a></p>Repeati1 – 30TEP1 N-terminal 1Add BLAST30
Repeati31 – 60TEP1 N-terminal 2Add BLAST30
Repeati61 – 90TEP1 N-terminal 3Add BLAST30
Repeati91 – 120TEP1 N-terminal 4Add BLAST30
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini223 – 676TROVEPROSITE-ProRule annotationAdd BLAST454
Domaini1162 – 1490NACHTPROSITE-ProRule annotationAdd BLAST329
Repeati1411 – 1448WD 1Add BLAST38
Repeati1674 – 1713WD 2Add BLAST40
Repeati1716 – 1754WD 3Add BLAST39
Repeati1757 – 1796WD 4Add BLAST40
Repeati1798 – 1837WD 5Add BLAST40
Repeati1840 – 1879WD 6Add BLAST40
Repeati1882 – 1921WD 7Add BLAST40
Repeati1925 – 1964WD 8Add BLAST40
Repeati1967 – 2005WD 9Add BLAST39
Repeati2008 – 2047WD 10Add BLAST40
Repeati2059 – 2098WD 11Add BLAST40
Repeati2105 – 2143WD 12Add BLAST39
Repeati2146 – 2183WD 13Add BLAST38
Repeati2185 – 2233WD 14Add BLAST49
Repeati2236 – 2275WD 15Add BLAST40
Repeati2278 – 2317WD 16Add BLAST40
Repeati2319 – 2355WD 17Add BLAST37
Repeati2368 – 2417WD 18Add BLAST50
Repeati2459 – 2500WD 19Add BLAST42
Repeati2553 – 2590WD 20Add BLAST38
Repeati2592 – 2626WD 21Add BLAST35

Keywords - Domaini

Repeat, WD repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG3602 Eukaryota
KOG4155 Eukaryota
ENOG410XP3K LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000161338

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000154545

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q99973

KEGG Orthology (KO)

More...
KOi
K11127

Identification of Orthologs from Complete Genome Data

More...
OMAi
EWQVELQ

Database of Orthologous Groups

More...
OrthoDBi
29963at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q99973

TreeFam database of animal gene trees

More...
TreeFami
TF328424

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
2.130.10.10, 6 hits

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR025139 DUF4062
IPR007111 NACHT_NTPase
IPR027417 P-loop_NTPase
IPR008850 TEP1_N
IPR008858 TROVE_dom
IPR037214 TROVE_dom_sf
IPR015943 WD40/YVTN_repeat-like_dom_sf
IPR001680 WD40_repeat
IPR019775 WD40_repeat_CS
IPR017986 WD40_repeat_dom
IPR036322 WD40_repeat_dom_sf

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF13271 DUF4062, 1 hit
PF05729 NACHT, 1 hit
PF05386 TEP1_N, 4 hits
PF05731 TROVE, 1 hit
PF00400 WD40, 5 hits

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00320 WD40, 18 hits

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF140864 SSF140864, 1 hit
SSF50978 SSF50978, 3 hits
SSF52540 SSF52540, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50837 NACHT, 1 hit
PS51226 TEP1_N, 4 hits
PS50988 TROVE, 1 hit
PS00678 WD_REPEATS_1, 1 hit
PS50082 WD_REPEATS_2, 7 hits
PS50294 WD_REPEATS_REGION, 2 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 9 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q99973-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MEKLHGHVSA HPDILSLENR CLAMLPDLQP LEKLHQHVST HSDILSLKNQ
60 70 80 90 100
CLATLPDLKT MEKPHGYVSA HPDILSLENQ CLATLSDLKT MEKPHGHVSA
110 120 130 140 150
HPDILSLENR CLATLSSLKS TVSASPLFQS LQISHMTQAD LYRVNNSNCL
160 170 180 190 200
LSEPPSWRAQ HFSKGLDLST CPIALKSISA TETAQEATLG RWFDSEEKKG
210 220 230 240 250
AETQMPSYSL SLGEEEEVED LAVKLTSGDS ESHPEPTDHV LQEKKMALLS
260 270 280 290 300
LLCSTLVSEV NMNNTSDPTL AAIFEICREL ALLEPEFILK ASLYARQQLN
310 320 330 340 350
VRNVANNILA IAAFLPACRP HLRRYFCAIV QLPSDWIQVA ELYQSLAEGD
360 370 380 390 400
KNKLVPLPAC LRTAMTDKFA QFDEYQLAKY NPRKHRAKRH PRRPPRSPGM
410 420 430 440 450
EPPFSHRCFP RYIGFLREEQ RKFEKAGDTV SEKKNPPRFT LKKLVQRLHI
460 470 480 490 500
HKPAQHVQAL LGYRYPSNLQ LFSRSRLPGP WDSSRAGKRM KLSRPETWER
510 520 530 540 550
ELSLRGNKAS VWEELIENGK LPFMAMLRNL CNLLRVGISS RHHELILQRL
560 570 580 590 600
QHAKSVIHSR QFPFRFLNAH DAIDALEAQL RNQALPFPSN ITLMRRILTR
610 620 630 640 650
NEKNRPRRRF LCHLSRQQLR MAMRIPVLYE QLKREKLRVH KARQWKYDGE
660 670 680 690 700
MLNRYRQALE TAVNLSVKHS LPLLPGRTVL VYLTDANADR LCPKSNPQGP
710 720 730 740 750
PLNYALLLIG MMITRAEQVD VVLCGGDTLK TAVLKAEEGI LKTAIKLQAQ
760 770 780 790 800
VQEFDENDGW SLNTFGKYLL SLAGQRVPVD RVILLGQSMD DGMINVAKQL
810 820 830 840 850
YWQRVNSKCL FVGILLRRVQ YLSTDLNPND VTLSGCTDAI LKFIAEHGAS
860 870 880 890 900
HLLEHVGQMD KIFKIPPPPG KTGVQSLRPL EEDTPSPLAP VSQQGWRSIR
910 920 930 940 950
LFISSTFRDM HGERDLLLRS VLPALQARAA PHRISLHGID LRWGVTEEET
960 970 980 990 1000
RRNRQLEVCL GEVENAQLFV GILGSRYGYI PPSYNLPDHP HFHWAQQYPS
1010 1020 1030 1040 1050
GRSVTEMEVM QFLNRNQRLQ PSAQALIYFR DSSFLSSVPD AWKSDFVSES
1060 1070 1080 1090 1100
EEAARRISEL KSYLSRQKGI TCRRYPCEWG GVAAGRPYVG GLEEFGQLVL
1110 1120 1130 1140 1150
QDVWNMIQKL YLQPGALLEQ PVSIPDDDLV QATFQQLQKP PSPARPRLLQ
1160 1170 1180 1190 1200
DTVQRLMLPH GRLSLVTGQS GQGKTAFLAS LVSALQAPDG AKVASLVFFH
1210 1220 1230 1240 1250
FSGARPDQGL ALTLLRRLCT YLRGQLKEPG ALPSTYRSLV WELQQRLLPK
1260 1270 1280 1290 1300
SAESLHPGQT QVLIIDGADR LVDQNGQLIS DWIPKKLPRC VHLVLSVSSD
1310 1320 1330 1340 1350
AGLGETLEQS QGAHVLALGP LEASARARLV REELALYGKR LEESPFNNQM
1360 1370 1380 1390 1400
RLLLVKRESG RPLYLRLVTD HLRLFTLYEQ VSERLRTLPA TVPLLLQHIL
1410 1420 1430 1440 1450
STLEKEHGPD VLPQALTALE VTRSGLTVDQ LHGVLSVWRT LPKGTKSWEE
1460 1470 1480 1490 1500
AVAAGNSGDP YPMGPFACLV QSLRSLLGEG PLERPGARLC LPDGPLRTAA
1510 1520 1530 1540 1550
KRCYGKRPGL EDTAHILIAA QLWKTCDADA SGTFRSCPPE ALGDLPYHLL
1560 1570 1580 1590 1600
QSGNRGLLSK FLTNLHVVAA HLELGLVSRL LEAHALYASS VPKEEQKLPE
1610 1620 1630 1640 1650
ADVAVFRTFL RQQASILSQY PRLLPQQAAN QPLDSPLCHQ ASLLSRRWHL
1660 1670 1680 1690 1700
QHTLRWLNKP RTMKNQQSSS LSLAVSSSPT AVAFSTNGQR AAVGTANGTV
1710 1720 1730 1740 1750
YLLDLRTWQE EKSVVSGCDG ISACLFLSDD TLFLTAFDGL LELWDLQHGC
1760 1770 1780 1790 1800
RVLQTKAHQY QITGCCLSPD CRLLATVCLG GCLKLWDTVR GQLAFQHTYP
1810 1820 1830 1840 1850
KSLNCVAFHP EGQVIATGSW AGSISFFQVD GLKVTKDLGA PGASIRTLAF
1860 1870 1880 1890 1900
NVPGGVVAVG RLDSMVELWA WREGARLAAF PAHHGFVAAA LFLHAGCQLL
1910 1920 1930 1940 1950
TAGEDGKVQV WSGSLGRPRG HLGSLSLSPA LSVALSPDGD RVAVGYRADG
1960 1970 1980 1990 2000
IRIYKISSGS QGAQGQALDV AVSALAWLSP KVLVSGAEDG SLQGWALKEC
2010 2020 2030 2040 2050
SLQSLWLLSR FQKPVLGLAT SQELLASASE DFTVQLWPRQ LLTRPHKAED
2060 2070 2080 2090 2100
FPCGTELRGH EGPVSCCSFS TDGGSLATGG RDRSLLCWDV RTPKTPVLIH
2110 2120 2130 2140 2150
SFPACHRDWV TGCAWTKDNL LISCSSDGSV GLWDPESGQR LGQFLGHQSA
2160 2170 2180 2190 2200
VSAVAAVEEH VVSVSRDGTL KVWDHQGVEL TSIPAHSGPI SHCAAAMEPR
2210 2220 2230 2240 2250
AAGQPGSELL VVTVGLDGAT RLWHPLLVCQ THTLLGHSGP VRAAAVSETS
2260 2270 2280 2290 2300
GLMLTASEDG SVRLWQVPKE ADDTCIPRSS AAVTAVAWAP DGSMAVSGNQ
2310 2320 2330 2340 2350
AGELILWQEA KAVATAQAPG HIGALIWSSA HTFFVLSADE KISEWQVKLR
2360 2370 2380 2390 2400
KGSAPGNLSL HLNRILQEDL GVLTSLDWAP DGHFLILAKA DLKLLCMKPG
2410 2420 2430 2440 2450
DAPSEIWSSY TENPMILSTH KEYGIFVLQP KDPGVLSFLR QKESGEFEER
2460 2470 2480 2490 2500
LNFDINLENP SRTLISITQA KPESESSFLC ASSDGILWNL AKCSPEGEWT
2510 2520 2530 2540 2550
TGNMWQKKAN TPETQTPGTD PSTCRESDAS MDSDASMDSE PTPHLKTRQR
2560 2570 2580 2590 2600
RKIHSGSVTA LHVLPELLVT ASKDRDVKLW ERPSMQLLGL FRCEGSVSCL
2610 2620
EPWLGANSTL QLAVGDVQGN VYFLNWE
Length:2,627
Mass (Da):290,490
Last modified:November 25, 2008 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i32628238704A8860
GO
Isoform 2 (identifier: Q99973-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     2475-2506: ESSFLCASSDGILWNLAKCSPEGEWTTGNMWQ → ALMGSYGTWPNAAQKENGPQVTCGR

Note: May be due to an exon inclusion.
Show »
Length:2,620
Mass (Da):289,578
Checksum:iD512FB76402A71C4
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 9 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
G3V5X7G3V5X7_HUMAN
Telomerase protein component 1
TEP1
2,519Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
G3V2A4G3V2A4_HUMAN
Telomerase protein component 1
TEP1
1,904Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
G3V470G3V470_HUMAN
Telomerase protein component 1
TEP1
1,481Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YIZ2H0YIZ2_HUMAN
Telomerase protein component 1
TEP1
201Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YIY9H0YIY9_HUMAN
Telomerase protein component 1
TEP1
250Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YJF6H0YJF6_HUMAN
Telomerase protein component 1
TEP1
102Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
G3V591G3V591_HUMAN
Telomerase protein component 1
TEP1
166Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YJ53H0YJ53_HUMAN
Telomerase protein component 1
TEP1
70Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YJP8H0YJP8_HUMAN
Telomerase protein component 1
TEP1
78Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_018490116S → P1 PublicationCorresponds to variant dbSNP:rs1760897Ensembl.1
Natural variantiVAR_047631137T → M. Corresponds to variant dbSNP:rs10083536Ensembl.1
Natural variantiVAR_018491307N → K. Corresponds to variant dbSNP:rs1760898Ensembl.1
Natural variantiVAR_047632368K → R. Corresponds to variant dbSNP:rs2228035Ensembl.1
Natural variantiVAR_047633434K → N. Corresponds to variant dbSNP:rs17111188Ensembl.1
Natural variantiVAR_047634510S → L. Corresponds to variant dbSNP:rs4982051Ensembl.1
Natural variantiVAR_047635553A → G1 PublicationCorresponds to variant dbSNP:rs76466486Ensembl.1
Natural variantiVAR_047636933R → H. Corresponds to variant dbSNP:rs34179031Ensembl.1
Natural variantiVAR_0184921055R → C1 PublicationCorresponds to variant dbSNP:rs1760903Ensembl.1
Natural variantiVAR_0476371155R → Q1 PublicationCorresponds to variant dbSNP:rs2228041Ensembl.1
Natural variantiVAR_0184931195S → P1 PublicationCorresponds to variant dbSNP:rs1760904Ensembl.1
Natural variantiVAR_0476381351R → Q. Corresponds to variant dbSNP:rs12886088Ensembl.1
Natural variantiVAR_0476391408G → R. Corresponds to variant dbSNP:rs2229100Ensembl.1
Natural variantiVAR_0184941447S → T. Corresponds to variant dbSNP:rs1713457Ensembl.1
Natural variantiVAR_0184951468C → Y. Corresponds to variant dbSNP:rs1713456Ensembl.1
Natural variantiVAR_0476401661R → Q. Corresponds to variant dbSNP:rs34401320Ensembl.1
Natural variantiVAR_0476411772R → Q. Corresponds to variant dbSNP:rs8022805Ensembl.1
Natural variantiVAR_0184962214V → I. Corresponds to variant dbSNP:rs1713449Ensembl.1
Natural variantiVAR_0476422310A → S. Corresponds to variant dbSNP:rs35929175Ensembl.1
Natural variantiVAR_0184972486I → M. Corresponds to variant dbSNP:rs938886Ensembl.1
Natural variantiVAR_0184982562H → R. Corresponds to variant dbSNP:rs2104978Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0103592475 – 2506ESSFL…GNMWQ → ALMGSYGTWPNAAQKENGPQ VTCGR in isoform 2. 1 PublicationAdd BLAST32

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
U86136 mRNA Translation: AAC51107.1
BC126107 mRNA Translation: AAI26108.1
BX640983 mRNA Translation: CAE45993.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS9548.1 [Q99973-1]

NCBI Reference Sequences

More...
RefSeqi
NP_009041.2, NM_007110.4 [Q99973-1]
XP_005268084.1, XM_005268027.4 [Q99973-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000262715; ENSP00000262715; ENSG00000129566 [Q99973-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
7011

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:7011

UCSC genome browser

More...
UCSCi
uc001vxe.4 human [Q99973-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U86136 mRNA Translation: AAC51107.1
BC126107 mRNA Translation: AAI26108.1
BX640983 mRNA Translation: CAE45993.1
CCDSiCCDS9548.1 [Q99973-1]
RefSeqiNP_009041.2, NM_007110.4 [Q99973-1]
XP_005268084.1, XM_005268027.4 [Q99973-1]

3D structure databases

SMRiQ99973
ModBaseiSearch...

Protein-protein interaction databases

BioGridi112870, 14 interactors
IntActiQ99973, 5 interactors
STRINGi9606.ENSP00000262715

PTM databases

iPTMnetiQ99973
PhosphoSitePlusiQ99973
SwissPalmiQ99973

Polymorphism and mutation databases

BioMutaiTEP1
DMDMi215273899

Proteomic databases

EPDiQ99973
jPOSTiQ99973
MaxQBiQ99973
PaxDbiQ99973
PeptideAtlasiQ99973
PRIDEiQ99973
ProteomicsDBi78559
78560 [Q99973-2]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000262715; ENSP00000262715; ENSG00000129566 [Q99973-1]
GeneIDi7011
KEGGihsa:7011
UCSCiuc001vxe.4 human [Q99973-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
7011
DisGeNETi7011

GeneCards: human genes, protein and diseases

More...
GeneCardsi
TEP1

H-Invitational Database, human transcriptome db

More...
H-InvDBi
HIX0026646
HGNCiHGNC:11726 TEP1
HPAiHPA029206
MIMi601686 gene
neXtProtiNX_Q99973
OpenTargetsiENSG00000129566
PharmGKBiPA36443

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG3602 Eukaryota
KOG4155 Eukaryota
ENOG410XP3K LUCA
GeneTreeiENSGT00940000161338
HOGENOMiHOG000154545
InParanoidiQ99973
KOiK11127
OMAiEWQVELQ
OrthoDBi29963at2759
PhylomeDBiQ99973
TreeFamiTF328424

Enzyme and pathway databases

SignaLinkiQ99973

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
TEP1 human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
TEP1

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
7011

Protein Ontology

More...
PROi
PR:Q99973

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000129566 Expressed in 190 organ(s), highest expression level in intestine
ExpressionAtlasiQ99973 baseline and differential
GenevisibleiQ99973 HS

Family and domain databases

Gene3Di2.130.10.10, 6 hits
InterProiView protein in InterPro
IPR025139 DUF4062
IPR007111 NACHT_NTPase
IPR027417 P-loop_NTPase
IPR008850 TEP1_N
IPR008858 TROVE_dom
IPR037214 TROVE_dom_sf
IPR015943 WD40/YVTN_repeat-like_dom_sf
IPR001680 WD40_repeat
IPR019775 WD40_repeat_CS
IPR017986 WD40_repeat_dom
IPR036322 WD40_repeat_dom_sf
PfamiView protein in Pfam
PF13271 DUF4062, 1 hit
PF05729 NACHT, 1 hit
PF05386 TEP1_N, 4 hits
PF05731 TROVE, 1 hit
PF00400 WD40, 5 hits
SMARTiView protein in SMART
SM00320 WD40, 18 hits
SUPFAMiSSF140864 SSF140864, 1 hit
SSF50978 SSF50978, 3 hits
SSF52540 SSF52540, 1 hit
PROSITEiView protein in PROSITE
PS50837 NACHT, 1 hit
PS51226 TEP1_N, 4 hits
PS50988 TROVE, 1 hit
PS00678 WD_REPEATS_1, 1 hit
PS50082 WD_REPEATS_2, 7 hits
PS50294 WD_REPEATS_REGION, 2 hits

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiTEP1_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q99973
Secondary accession number(s): A0AUV9
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 24, 2004
Last sequence update: November 25, 2008
Last modified: May 8, 2019
This is version 169 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. Human chromosome 14
    Human chromosome 14: entries, gene names and cross-references to MIM
  4. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again