Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 182 (08 May 2019)
Sequence version 1 (01 May 1997)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Endophilin-A3

Gene

SH3GL3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Implicated in endocytosis. May recruit other proteins to membranes with high curvature (By similarity).By similarity

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processEndocytosis
LigandLipid-binding

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-182971 EGFR downregulation
R-HSA-6807004 Negative regulation of MET activity
R-HSA-8856825 Cargo recognition for clathrin-mediated endocytosis
R-HSA-8856828 Clathrin-mediated endocytosis
R-HSA-8875360 InlB-mediated entry of Listeria monocytogenes into host cell

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Endophilin-A3
Alternative name(s):
EEN-B2
Endophilin-3
SH3 domain protein 2C
SH3 domain-containing GRB2-like protein 3
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:SH3GL3
Synonyms:CNSA3, SH3D2C
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 15

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:10832 SH3GL3

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
603362 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q99963

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Endosome, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
6457

Open Targets

More...
OpenTargetsi
ENSG00000140600

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA35738

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
SH3GL3

Domain mapping of disease mutations (DMDM)

More...
DMDMi
12643798

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001467501 – 347Endophilin-A3Add BLAST347

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei265PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q99963

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q99963

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q99963

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q99963

PeptideAtlas

More...
PeptideAtlasi
Q99963

PRoteomics IDEntifications database

More...
PRIDEi
Q99963

ProteomicsDB human proteome resource

More...
ProteomicsDBi
78547
78548 [Q99963-2]
78549 [Q99963-3]
78550 [Q99963-4]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q99963

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q99963

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Brain and testis.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000140600 Expressed in 150 organ(s), highest expression level in sperm

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q99963 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q99963 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA039381

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with ARC (By similarity). Interacts with DNM1, SGIP1 and SYNJ1. Interacts with the huntingtin exon 1 protein (HDEX1P) containing a glutamine repeat in the pathological range and promotes formation of insoluble polyglutamine-containing aggregates in vivo. Interacts with DYDC1. Interacts with FASLG. Interacts with ATX2. Interacts with BIN2.By similarity7 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
112354, 43 interactors

CORUM comprehensive resource of mammalian protein complexes

More...
CORUMi
Q99963

Database of interacting proteins

More...
DIPi
DIP-34766N

Protein interaction database and analysis system

More...
IntActi
Q99963, 55 interactors

Molecular INTeraction database

More...
MINTi
Q99963

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000320092

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1347
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2EW3NMR-A285-345[»]
2Z0VX-ray2.49A/B24-256[»]

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q99963

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
Q99963

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini18 – 249BARPROSITE-ProRule annotationAdd BLAST232
Domaini285 – 344SH3PROSITE-ProRule annotationAdd BLAST60

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni1 – 21Membrane-binding amphipathic helixBy similarityAdd BLAST21
Regioni60 – 87Required for dimerization upon membrane associationBy similarityAdd BLAST28
Regioni218 – 254Interaction with ARCBy similarityAdd BLAST37

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and domains’ section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili181 – 201Sequence analysisAdd BLAST21

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

An N-terminal amphipathic helix, the BAR domain and a second amphipathic helix inserted into helix 1 of the BAR domain (N-BAR domain) induce membrane curvature and bind curved membranes.By similarity

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the endophilin family.Curated

Keywords - Domaini

Coiled coil, SH3 domain

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG1118 Eukaryota
ENOG410XNYB LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000157398

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000231641

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q99963

KEGG Orthology (KO)

More...
KOi
K11247

Identification of Orthologs from Complete Genome Data

More...
OMAi
NVPMDQP

Database of Orthologous Groups

More...
OrthoDBi
788657at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q99963

TreeFam database of animal gene trees

More...
TreeFami
TF313281

Family and domain databases

Conserved Domains Database

More...
CDDi
cd07615 BAR_Endophilin_A3, 1 hit
cd11803 SH3_Endophilin_A, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.20.1270.60, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR027267 AH/BAR_dom_sf
IPR004148 BAR_dom
IPR028501 Endophilin-A
IPR032469 Endophilin-A3_BAR
IPR035824 Endophilin_A_SH3
IPR036028 SH3-like_dom_sf
IPR001452 SH3_domain

The PANTHER Classification System

More...
PANTHERi
PTHR14167:SF45 PTHR14167:SF45, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF03114 BAR, 1 hit
PF07653 SH3_2, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR00452 SH3DOMAIN

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00721 BAR, 1 hit
SM00326 SH3, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF103657 SSF103657, 1 hit
SSF50044 SSF50044, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS51021 BAR, 1 hit
PS50002 SH3, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: Q99963-1) [UniParc]FASTAAdd to basket
Also known as: EEN-B2-L1

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSVAGLKKQF HKASQLFSEK ISGAEGTKLD DEFLDMERKI DVTNKVVAEI
60 70 80 90 100
LSKTTEYLQP NPAYRAKLGM LNTVSKIRGQ VKTTGYPQTE GLLGDCMLKY
110 120 130 140 150
GKELGEDSTF GNALIEVGES MKLMAEVKDS LDINVKQTFI DPLQLLQDKD
160 170 180 190 200
LKEIGHHLKK LEGRRLDYDY KKKRVGKIPD EEVRQAVEKF EESKELAERS
210 220 230 240 250
MFNFLENDVE QVSQLAVFIE AALDYHRQST EILQELQSKL QMRISAASSV
260 270 280 290 300
PRREYKPRPV KRSSSELNGV STTSVVKTTG SNIPMDQPCC RGLYDFEPEN
310 320 330 340
QGELGFKEGD IITLTNQIDE NWYEGMIHGE SGFFPINYVE VIVPLPQ
Length:347
Mass (Da):39,285
Last modified:May 1, 1997 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iD68DA7B28574C4E6
GO
Isoform 2 (identifier: Q99963-2) [UniParc]FASTAAdd to basket
Also known as: EEN-B2-L2

The sequence of this isoform differs from the canonical sequence as follows:
     1-69: Missing.

Show »
Length:278
Mass (Da):31,587
Checksum:iE0C2DDBD871FBB09
GO
Isoform 3 (identifier: Q99963-3) [UniParc]FASTAAdd to basket
Also known as: EEN-B2-L3

The sequence of this isoform differs from the canonical sequence as follows:
     1-14: MSVAGLKKQFHKAS → MDGIFAGIICNQANRCLTWTSQ

Show »
Length:355
Mass (Da):40,196
Checksum:iAB91D787F6C13AFC
GO
Isoform 4 (identifier: Q99963-4) [UniParc]FASTAAdd to basket
Also known as: EEN-B2-L4

The sequence of this isoform differs from the canonical sequence as follows:
     311-347: IITLTNQIDENWYEGMIHGESGFFPINYVEVIVPLPQ → GTFRKIKRETKIKMCRKKIVNIYKLKDQQH

Show »
Length:340
Mass (Da):38,739
Checksum:iBC523D052F3E0114
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H3BRH8H3BRH8_HUMAN
Endophilin-A3
SH3GL3
65Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0014411 – 69Missing in isoform 2. 1 PublicationAdd BLAST69
Alternative sequenceiVSP_0014401 – 14MSVAG…FHKAS → MDGIFAGIICNQANRCLTWT SQ in isoform 3. 1 PublicationAdd BLAST14
Alternative sequenceiVSP_001442311 – 347IITLT…VPLPQ → GTFRKIKRETKIKMCRKKIV NIYKLKDQQH in isoform 4. 1 PublicationAdd BLAST37

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
X99664 mRNA Translation: CAA67978.1
AF036269 mRNA Translation: AAC04765.1
AF036270 mRNA Translation: AAC04766.1
AF036271 mRNA Translation: AAC04767.1
AF036272 mRNA Translation: AAC04768.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS10325.2 [Q99963-1]
CCDS73772.1 [Q99963-3]

NCBI Reference Sequences

More...
RefSeqi
NP_001288037.1, NM_001301108.1 [Q99963-2]
NP_001288038.1, NM_001301109.1 [Q99963-3]
NP_001311112.1, NM_001324183.1 [Q99963-3]
NP_001311114.1, NM_001324185.1 [Q99963-2]
NP_001311116.1, NM_001324187.1 [Q99963-2]
NP_003018.3, NM_003027.4 [Q99963-1]
XP_011520191.1, XM_011521889.1 [Q99963-3]
XP_016877975.1, XM_017022486.1 [Q99963-2]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000324537; ENSP00000320092; ENSG00000140600 [Q99963-3]
ENST00000427482; ENSP00000391372; ENSG00000140600 [Q99963-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
6457

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:6457

UCSC genome browser

More...
UCSCi
uc002bju.4 human [Q99963-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X99664 mRNA Translation: CAA67978.1
AF036269 mRNA Translation: AAC04765.1
AF036270 mRNA Translation: AAC04766.1
AF036271 mRNA Translation: AAC04767.1
AF036272 mRNA Translation: AAC04768.1
CCDSiCCDS10325.2 [Q99963-1]
CCDS73772.1 [Q99963-3]
RefSeqiNP_001288037.1, NM_001301108.1 [Q99963-2]
NP_001288038.1, NM_001301109.1 [Q99963-3]
NP_001311112.1, NM_001324183.1 [Q99963-3]
NP_001311114.1, NM_001324185.1 [Q99963-2]
NP_001311116.1, NM_001324187.1 [Q99963-2]
NP_003018.3, NM_003027.4 [Q99963-1]
XP_011520191.1, XM_011521889.1 [Q99963-3]
XP_016877975.1, XM_017022486.1 [Q99963-2]

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2EW3NMR-A285-345[»]
2Z0VX-ray2.49A/B24-256[»]
SMRiQ99963
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi112354, 43 interactors
CORUMiQ99963
DIPiDIP-34766N
IntActiQ99963, 55 interactors
MINTiQ99963
STRINGi9606.ENSP00000320092

PTM databases

iPTMnetiQ99963
PhosphoSitePlusiQ99963

Polymorphism and mutation databases

BioMutaiSH3GL3
DMDMi12643798

Proteomic databases

EPDiQ99963
jPOSTiQ99963
MaxQBiQ99963
PaxDbiQ99963
PeptideAtlasiQ99963
PRIDEiQ99963
ProteomicsDBi78547
78548 [Q99963-2]
78549 [Q99963-3]
78550 [Q99963-4]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
6457
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000324537; ENSP00000320092; ENSG00000140600 [Q99963-3]
ENST00000427482; ENSP00000391372; ENSG00000140600 [Q99963-1]
GeneIDi6457
KEGGihsa:6457
UCSCiuc002bju.4 human [Q99963-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
6457
DisGeNETi6457

GeneCards: human genes, protein and diseases

More...
GeneCardsi
SH3GL3

H-Invitational Database, human transcriptome db

More...
H-InvDBi
HIX0026775
HGNCiHGNC:10832 SH3GL3
HPAiHPA039381
MIMi603362 gene
neXtProtiNX_Q99963
OpenTargetsiENSG00000140600
PharmGKBiPA35738

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG1118 Eukaryota
ENOG410XNYB LUCA
GeneTreeiENSGT00940000157398
HOGENOMiHOG000231641
InParanoidiQ99963
KOiK11247
OMAiNVPMDQP
OrthoDBi788657at2759
PhylomeDBiQ99963
TreeFamiTF313281

Enzyme and pathway databases

ReactomeiR-HSA-182971 EGFR downregulation
R-HSA-6807004 Negative regulation of MET activity
R-HSA-8856825 Cargo recognition for clathrin-mediated endocytosis
R-HSA-8856828 Clathrin-mediated endocytosis
R-HSA-8875360 InlB-mediated entry of Listeria monocytogenes into host cell

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
SH3GL3 human
EvolutionaryTraceiQ99963

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
SH3GL3

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
6457

Protein Ontology

More...
PROi
PR:Q99963

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000140600 Expressed in 150 organ(s), highest expression level in sperm
ExpressionAtlasiQ99963 baseline and differential
GenevisibleiQ99963 HS

Family and domain databases

CDDicd07615 BAR_Endophilin_A3, 1 hit
cd11803 SH3_Endophilin_A, 1 hit
Gene3Di1.20.1270.60, 1 hit
InterProiView protein in InterPro
IPR027267 AH/BAR_dom_sf
IPR004148 BAR_dom
IPR028501 Endophilin-A
IPR032469 Endophilin-A3_BAR
IPR035824 Endophilin_A_SH3
IPR036028 SH3-like_dom_sf
IPR001452 SH3_domain
PANTHERiPTHR14167:SF45 PTHR14167:SF45, 1 hit
PfamiView protein in Pfam
PF03114 BAR, 1 hit
PF07653 SH3_2, 1 hit
PRINTSiPR00452 SH3DOMAIN
SMARTiView protein in SMART
SM00721 BAR, 1 hit
SM00326 SH3, 1 hit
SUPFAMiSSF103657 SSF103657, 1 hit
SSF50044 SSF50044, 1 hit
PROSITEiView protein in PROSITE
PS51021 BAR, 1 hit
PS50002 SH3, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiSH3G3_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q99963
Secondary accession number(s): O43553, O43554
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: December 1, 2000
Last sequence update: May 1, 1997
Last modified: May 8, 2019
This is version 182 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 15
    Human chromosome 15: entries, gene names and cross-references to MIM
  2. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  3. SIMILARITY comments
    Index of protein domains and families
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again