Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Endophilin-A3

Gene

SH3GL3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Implicated in endocytosis. May recruit other proteins to membranes with high curvature (By similarity).By similarity

GO - Molecular functioni

  • identical protein binding Source: IntAct
  • lipid binding Source: UniProtKB-KW
  • protein C-terminus binding Source: Ensembl

GO - Biological processi

  • central nervous system development Source: ProtInc
  • endocytosis Source: UniProtKB-KW
  • negative regulation of clathrin-dependent endocytosis Source: Ensembl
  • positive regulation of neuron differentiation Source: Ensembl
  • signal transduction Source: ProtInc

Keywordsi

Biological processEndocytosis
LigandLipid-binding

Enzyme and pathway databases

ReactomeiR-HSA-182971 EGFR downregulation
R-HSA-6807004 Negative regulation of MET activity
R-HSA-8856825 Cargo recognition for clathrin-mediated endocytosis
R-HSA-8856828 Clathrin-mediated endocytosis
R-HSA-8875360 InlB-mediated entry of Listeria monocytogenes into host cell

Names & Taxonomyi

Protein namesi
Recommended name:
Endophilin-A3
Alternative name(s):
EEN-B2
Endophilin-3
SH3 domain protein 2C
SH3 domain-containing GRB2-like protein 3
Gene namesi
Name:SH3GL3
Synonyms:CNSA3, SH3D2C
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 15

Organism-specific databases

EuPathDBiHostDB:ENSG00000140600.16
HGNCiHGNC:10832 SH3GL3
MIMi603362 gene
neXtProtiNX_Q99963

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Endosome, Membrane

Pathology & Biotechi

Organism-specific databases

DisGeNETi6457
OpenTargetsiENSG00000140600
PharmGKBiPA35738

Polymorphism and mutation databases

BioMutaiSH3GL3
DMDMi12643798

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001467501 – 347Endophilin-A3Add BLAST347

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei265PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ99963
MaxQBiQ99963
PaxDbiQ99963
PeptideAtlasiQ99963
PRIDEiQ99963
ProteomicsDBi78547
78548 [Q99963-2]
78549 [Q99963-3]
78550 [Q99963-4]

PTM databases

iPTMnetiQ99963
PhosphoSitePlusiQ99963

Expressioni

Tissue specificityi

Brain and testis.

Gene expression databases

BgeeiENSG00000140600
CleanExiHS_SH3GL3
ExpressionAtlasiQ99963 baseline and differential
GenevisibleiQ99963 HS

Organism-specific databases

HPAiHPA039381

Interactioni

Subunit structurei

Interacts with ARC (By similarity). Interacts with DNM1, SGIP1 and SYNJ1. Interacts with the huntingtin exon 1 protein (HDEX1P) containing a glutamine repeat in the pathological range and promotes formation of insoluble polyglutamine-containing aggregates in vivo. Interacts with DYDC1. Interacts with FASLG. Interacts with ATX2. Interacts with BIN2.By similarity7 Publications

Binary interactionsi

Show more details

GO - Molecular functioni

  • identical protein binding Source: IntAct
  • protein C-terminus binding Source: Ensembl

Protein-protein interaction databases

BioGridi112354, 43 interactors
CORUMiQ99963
DIPiDIP-34766N
IntActiQ99963, 52 interactors
MINTiQ99963
STRINGi9606.ENSP00000391372

Structurei

Secondary structure

1347
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Helixi31 – 58Combined sources28
Helixi62 – 69Combined sources8
Helixi89 – 104Combined sources16
Helixi109 – 138Combined sources30
Helixi140 – 148Combined sources9
Helixi150 – 172Combined sources23
Turni173 – 176Combined sources4
Helixi180 – 206Combined sources27
Helixi209 – 246Combined sources38
Beta strandi289 – 294Combined sources6
Beta strandi311 – 327Combined sources17
Beta strandi330 – 335Combined sources6
Helixi336 – 338Combined sources3
Beta strandi339 – 342Combined sources4

3D structure databases

ProteinModelPortaliQ99963
SMRiQ99963
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ99963

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini18 – 249BARPROSITE-ProRule annotationAdd BLAST232
Domaini285 – 344SH3PROSITE-ProRule annotationAdd BLAST60

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni1 – 21Membrane-binding amphipathic helixBy similarityAdd BLAST21
Regioni60 – 87Required for dimerization upon membrane associationBy similarityAdd BLAST28
Regioni218 – 254Interaction with ARCBy similarityAdd BLAST37

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili181 – 201Sequence analysisAdd BLAST21

Domaini

An N-terminal amphipathic helix, the BAR domain and a second amphipathic helix inserted into helix 1 of the BAR domain (N-BAR domain) induce membrane curvature and bind curved membranes.By similarity

Sequence similaritiesi

Belongs to the endophilin family.Curated

Keywords - Domaini

Coiled coil, SH3 domain

Phylogenomic databases

eggNOGiKOG1118 Eukaryota
ENOG410XNYB LUCA
GeneTreeiENSGT00550000074464
HOGENOMiHOG000231641
HOVERGENiHBG052866
InParanoidiQ99963
KOiK11247
OMAiNVPMDQP
OrthoDBiEOG091G16FW
PhylomeDBiQ99963
TreeFamiTF313281

Family and domain databases

CDDicd07615 BAR_Endophilin_A3, 1 hit
cd11803 SH3_Endophilin_A, 1 hit
Gene3Di1.20.1270.60, 1 hit
InterProiView protein in InterPro
IPR027267 AH/BAR_dom_sf
IPR004148 BAR_dom
IPR028501 Endophilin-A
IPR032469 Endophilin-A3_BAR
IPR035824 Endophilin_A_SH3
IPR036028 SH3-like_dom_sf
IPR001452 SH3_domain
PANTHERiPTHR43965 PTHR43965, 1 hit
PfamiView protein in Pfam
PF03114 BAR, 1 hit
PF07653 SH3_2, 1 hit
PRINTSiPR00452 SH3DOMAIN
SMARTiView protein in SMART
SM00721 BAR, 1 hit
SM00326 SH3, 1 hit
SUPFAMiSSF103657 SSF103657, 1 hit
SSF50044 SSF50044, 1 hit
PROSITEiView protein in PROSITE
PS51021 BAR, 1 hit
PS50002 SH3, 1 hit

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q99963-1) [UniParc]FASTAAdd to basket
Also known as: EEN-B2-L1

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSVAGLKKQF HKASQLFSEK ISGAEGTKLD DEFLDMERKI DVTNKVVAEI
60 70 80 90 100
LSKTTEYLQP NPAYRAKLGM LNTVSKIRGQ VKTTGYPQTE GLLGDCMLKY
110 120 130 140 150
GKELGEDSTF GNALIEVGES MKLMAEVKDS LDINVKQTFI DPLQLLQDKD
160 170 180 190 200
LKEIGHHLKK LEGRRLDYDY KKKRVGKIPD EEVRQAVEKF EESKELAERS
210 220 230 240 250
MFNFLENDVE QVSQLAVFIE AALDYHRQST EILQELQSKL QMRISAASSV
260 270 280 290 300
PRREYKPRPV KRSSSELNGV STTSVVKTTG SNIPMDQPCC RGLYDFEPEN
310 320 330 340
QGELGFKEGD IITLTNQIDE NWYEGMIHGE SGFFPINYVE VIVPLPQ
Length:347
Mass (Da):39,285
Last modified:May 1, 1997 - v1
Checksum:iD68DA7B28574C4E6
GO
Isoform 2 (identifier: Q99963-2) [UniParc]FASTAAdd to basket
Also known as: EEN-B2-L2

The sequence of this isoform differs from the canonical sequence as follows:
     1-69: Missing.

Show »
Length:278
Mass (Da):31,587
Checksum:iE0C2DDBD871FBB09
GO
Isoform 3 (identifier: Q99963-3) [UniParc]FASTAAdd to basket
Also known as: EEN-B2-L3

The sequence of this isoform differs from the canonical sequence as follows:
     1-14: MSVAGLKKQFHKAS → MDGIFAGIICNQANRCLTWTSQ

Show »
Length:355
Mass (Da):40,196
Checksum:iAB91D787F6C13AFC
GO
Isoform 4 (identifier: Q99963-4) [UniParc]FASTAAdd to basket
Also known as: EEN-B2-L4

The sequence of this isoform differs from the canonical sequence as follows:
     311-347: IITLTNQIDENWYEGMIHGESGFFPINYVEVIVPLPQ → GTFRKIKRETKIKMCRKKIVNIYKLKDQQH

Show »
Length:340
Mass (Da):38,739
Checksum:iBC523D052F3E0114
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0014411 – 69Missing in isoform 2. 1 PublicationAdd BLAST69
Alternative sequenceiVSP_0014401 – 14MSVAG…FHKAS → MDGIFAGIICNQANRCLTWT SQ in isoform 3. 1 PublicationAdd BLAST14
Alternative sequenceiVSP_001442311 – 347IITLT…VPLPQ → GTFRKIKRETKIKMCRKKIV NIYKLKDQQH in isoform 4. 1 PublicationAdd BLAST37

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X99664 mRNA Translation: CAA67978.1
AF036269 mRNA Translation: AAC04765.1
AF036270 mRNA Translation: AAC04766.1
AF036271 mRNA Translation: AAC04767.1
AF036272 mRNA Translation: AAC04768.1
CCDSiCCDS10325.2 [Q99963-1]
CCDS73772.1 [Q99963-3]
RefSeqiNP_001288037.1, NM_001301108.1 [Q99963-2]
NP_001288038.1, NM_001301109.1 [Q99963-3]
NP_001311112.1, NM_001324183.1 [Q99963-3]
NP_001311114.1, NM_001324185.1 [Q99963-2]
NP_001311116.1, NM_001324187.1 [Q99963-2]
NP_003018.3, NM_003027.4 [Q99963-1]
XP_011520191.1, XM_011521889.1 [Q99963-3]
XP_016877975.1, XM_017022486.1 [Q99963-2]
UniGeneiHs.270055

Genome annotation databases

EnsembliENST00000324537; ENSP00000320092; ENSG00000140600 [Q99963-3]
ENST00000427482; ENSP00000391372; ENSG00000140600 [Q99963-1]
GeneIDi6457
KEGGihsa:6457
UCSCiuc002bju.4 human [Q99963-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiSH3G3_HUMAN
AccessioniPrimary (citable) accession number: Q99963
Secondary accession number(s): O43553, O43554
Entry historyiIntegrated into UniProtKB/Swiss-Prot: December 1, 2000
Last sequence update: May 1, 1997
Last modified: July 18, 2018
This is version 175 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 15
    Human chromosome 15: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  4. SIMILARITY comments
    Index of protein domains and families

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health