Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - Q99932 (SPAG8_HUMAN)

Protein

Sperm-associated antigen 8

Gene

SPAG8

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Plays a role in spermatogenesis by enhancing the binding of CREM isoform tau to its coactivator FHL5 and increasing the FHL5-regulated transcriptional activation of CREM isoform tau (By similarity). Involved in the acrosome reaction and in binding of sperm to the zona pellucida (By similarity). Plays a role in regulation of the cell cycle by controlling progression through the G2/M phase, possibly by delaying the activation of CDK1 which is required for entry into mitosis (PubMed:19548270). May play a role in fertility and microtubule formation through interaction with RANBP9 (PubMed:10500252).By similarity2 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

View the complete GO annotation on QuickGO ...

GO - Biological processi

View the complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processCell cycle, Differentiation, Fertilization, Spermatogenesis

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Sperm-associated antigen 8
Alternative name(s):
HSD-1
Sperm membrane protein 1
Short name:
SMP-1
Sperm membrane protein BS-84
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:SPAG8
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 9

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...EuPathDBi		HostDB:ENSG00000137098.13

Human Gene Nomenclature Database

More...HGNCi		HGNC:14105 SPAG8

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		605731 gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_Q99932

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Cytoplasmic vesicle, Cytoskeleton, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...DisGeNETi		26206

Open Targets

More...OpenTargetsi		ENSG00000137098

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA37843

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		SPAG8

Domain mapping of disease mutations (DMDM)

More...DMDMi		62511128

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000720991 – 426Sperm-associated antigen 8Add BLAST426

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q99932

PeptideAtlas

More...PeptideAtlasi		Q99932

PRoteomics IDEntifications database

More...PRIDEi		Q99932

ProteomicsDB human proteome resource

More...ProteomicsDBi		78524
78525 [Q99932-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q99932

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q99932

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in testis (germ cells), but not in liver, kidney, prostate and small intestine.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000137098 Expressed in 209 organ(s), highest expression level in right uterine tube

CleanEx database of gene expression profiles

More...CleanExi		HS_SPAG8

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		Q99932 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q99932 HS

Organism-specific databases

Human Protein Atlas

More...HPAi		HPA068012

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with FHL5 (via second LIM domain) (By similarity). Interacts with RANBP9 (PubMed:15014887).By similarity1 Publication

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

View the complete GO annotation on QuickGO ...

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...BioGridi		117606, 16 interactors

Protein interaction database and analysis system

More...IntActi		Q99932, 89 interactors

Molecular INTeraction database

More...MINTi		Q99932

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000340982

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...ProteinModelPortali		Q99932

Database of comparative protein structure models

More...ModBasei		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi43 – 71Ala-richAdd BLAST29
Compositional biasi136 – 204Gly-richAdd BLAST69

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the SPAG8 family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		ENOG410IYX0 Eukaryota
ENOG4111NK4 LUCA

Ensembl GeneTree

More...GeneTreei		ENSGT00640000091617

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		HOG000294170

The HOVERGEN Database of Homologous Vertebrate Genes

More...HOVERGENi		HBG059013

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q99932

Identification of Orthologs from Complete Genome Data

More...OMAi		HWEPQKQ

Database of Orthologous Groups

More...OrthoDBi		EOG091G0GY7

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q99932

TreeFam database of animal gene trees

More...TreeFami		TF329075

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR026124 Sperm-assoc_Ag8

The PANTHER Classification System

More...PANTHERi		PTHR15510 PTHR15510, 2 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 4 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q99932-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
METNESTEGS RSRSRSLDIQ PSSEGLGPTS EPFPSSDDSP RSALAAATAA 
        60         70         80         90        100
AAAAASAAAA TAAFTTAKAA ALSTKTPAPC SEFMEPSSDP SLLGEPCAGP 
       110        120        130        140        150
GFTHNIAHGS LGFEPVYVSC IAQDTCTTTD HSSNPGPVPG SSSGPVLGSS 
       160        170        180        190        200
SGAGHGSGSG SGPGCGSVPG SGSGPGPGSG PGSGPGHGSG SHPGPASGPG 
       210        220        230        240        250
PDTGPDSELS PCIPPGFRNL VADRVPNYTS WSQHCPWEPQ KQPPWEFLQV 
       260        270        280        290        300
LEPGARGLWK PPDIKGKLMV CYETLPRGQC LLYNWEEERA TNHLDQVPSM 
       310        320        330        340        350
QDGSESFFFR HGHRGLLTMQ LKSPMPSSTT QKDSYQPPGN VYWPLRGKRE 
       360        370        380        390        400
AMLEMLLQHQ ICKEVQAEQE PTRKLFEVES VTHHDYRMEL AQAGTPAPTK 
       410        420 
PHDYRQEQPE TFWIQRAPQL PVCEGD
Length:426
Mass (Da):44,819
Last modified:April 12, 2005 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i7CFF3447202CA270
GO
Isoform 2 (identifier: Q99932-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     422-426: VCEGD → TWWPLPTQVP...KTVTQEDRGW

Note: No experimental confirmation available.
Show »
Length:501
Mass (Da):53,507
Checksum:iF7A14ED49DF6CE03
GO
Isoform 3 (identifier: Q99932-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     422-426: VCEGD → GVSNIRTLDTPFRKNCSFSTPVPLSLGKLLPYEPENYPYQLGEISSLPCPGGRLGGGGGRMTPF

Note: No experimental confirmation available.Curated
Show »
Length:485
Mass (Da):51,139
Checksum:i206A2AE68C5A4887
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 4 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
C9JAA8C9JAA8_HUMAN
Sperm-associated antigen 8
SPAG8
477Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F8WBP3F8WBP3_HUMAN
Sperm-associated antigen 8
SPAG8
96Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H7C4J6H7C4J6_HUMAN
Sperm-associated antigen 8
SPAG8
483Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F2Z302F2Z302_HUMAN
Sperm-associated antigen 8
SPAG8
69Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAB46833 differs from that shown. Reason: Erroneous termination at position 427. Translated as stop.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti5E → G in AAH19247 (PubMed:15489334).Curated1
Sequence conflicti48T → A in BAG63651 (PubMed:14702039).Curated1
Sequence conflicti49A → S in AAB46833 (PubMed:8788182).Curated1
Sequence conflicti176 – 179Missing in BAG63651 (PubMed:14702039).Curated4
Sequence conflicti269M → Q in AAB46833 (PubMed:8788182).Curated1
Sequence conflicti322K → T in AAB46833 (PubMed:8788182).Curated1
Isoform 3 (identifier: Q99932-3)
Sequence conflicti438S → G in BAG63651 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_05699269A → T. Corresponds to variant dbSNP:rs13299596Ensembl.1
Natural variantiVAR_069166226P → L1 PublicationCorresponds to variant dbSNP:rs17851728Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_013274422 – 426VCEGD → TWWPLPTQVPAAEDYLTWKE WGFTGVQEVLSALLRATPGE YSVNICGMNEHPVCSRTWTN RLCHQEMGSKKTVTQEDRGW in isoform 2. 1 Publication5
Alternative sequenceiVSP_046325422 – 426VCEGD → GVSNIRTLDTPFRKNCSFST PVPLSLGKLLPYEPENYPYQ LGEISSLPCPGGRLGGGGGR MTPF in isoform 3. 1 Publication5

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
S83157 mRNA Translation: AAB46833.1 Sequence problems.
U12978 mRNA Translation: AAA21129.2
AK302313 mRNA Translation: BAG63651.1
AL133410 Genomic DNA No translation available.
BC019247 mRNA Translation: AAH19247.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS43798.1 [Q99932-3]
CCDS6592.1 [Q99932-2]

NCBI Reference Sequences

More...RefSeqi		NP_001034681.1, NM_001039592.1 [Q99932-3]
NP_758516.1, NM_172312.1 [Q99932-2]

UniGene gene-oriented nucleotide sequence clusters

More...UniGenei		Hs.256747

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000340291; ENSP00000340982; ENSG00000137098 [Q99932-2]
ENST00000396638; ENSP00000379878; ENSG00000137098 [Q99932-3]
ENST00000475644; ENSP00000418530; ENSG00000137098 [Q99932-1]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		26206

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:26206

UCSC genome browser

More...UCSCi		uc003zye.4 human [Q99932-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
S83157 mRNA Translation: AAB46833.1 Sequence problems.
U12978 mRNA Translation: AAA21129.2
AK302313 mRNA Translation: BAG63651.1
AL133410 Genomic DNA No translation available.
BC019247 mRNA Translation: AAH19247.1
CCDSiCCDS43798.1 [Q99932-3]
CCDS6592.1 [Q99932-2]
RefSeqiNP_001034681.1, NM_001039592.1 [Q99932-3]
NP_758516.1, NM_172312.1 [Q99932-2]
UniGeneiHs.256747

3D structure databases

ProteinModelPortaliQ99932
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi117606, 16 interactors
IntActiQ99932, 89 interactors
MINTiQ99932
STRINGi9606.ENSP00000340982

PTM databases

iPTMnetiQ99932
PhosphoSitePlusiQ99932

Polymorphism and mutation databases

BioMutaiSPAG8
DMDMi62511128

Proteomic databases

PaxDbiQ99932
PeptideAtlasiQ99932
PRIDEiQ99932
ProteomicsDBi78524
78525 [Q99932-2]

Protocols and materials databases

The DNASU plasmid repository

More...DNASUi		26206
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000340291; ENSP00000340982; ENSG00000137098 [Q99932-2]
ENST00000396638; ENSP00000379878; ENSG00000137098 [Q99932-3]
ENST00000475644; ENSP00000418530; ENSG00000137098 [Q99932-1]
GeneIDi26206
KEGGihsa:26206
UCSCiuc003zye.4 human [Q99932-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		26206
DisGeNETi26206
EuPathDBiHostDB:ENSG00000137098.13

GeneCards: human genes, protein and diseases

More...GeneCardsi		SPAG8

H-Invitational Database, human transcriptome db

More...H-InvDBi		HIX0201390
HGNCiHGNC:14105 SPAG8
HPAiHPA068012
MIMi605731 gene
neXtProtiNX_Q99932
OpenTargetsiENSG00000137098
PharmGKBiPA37843

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiENOG410IYX0 Eukaryota
ENOG4111NK4 LUCA
GeneTreeiENSGT00640000091617
HOGENOMiHOG000294170
HOVERGENiHBG059013
InParanoidiQ99932
OMAiHWEPQKQ
OrthoDBiEOG091G0GY7
PhylomeDBiQ99932
TreeFamiTF329075

Miscellaneous databases

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		SPAG8

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		26206

Protein Ontology

More...PROi		PR:Q99932

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000137098 Expressed in 209 organ(s), highest expression level in right uterine tube
CleanExiHS_SPAG8
ExpressionAtlasiQ99932 baseline and differential
GenevisibleiQ99932 HS

Family and domain databases

InterProiView protein in InterPro
IPR026124 Sperm-assoc_Ag8
PANTHERiPTHR15510 PTHR15510, 2 hits

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiSPAG8_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q99932
Secondary accession number(s): B4DY89
, E9PDV6, Q12937, Q5TCV8, Q8WWB4
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 12, 2005
Last sequence update: April 12, 2005
Last modified: December 5, 2018
This is version 134 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 9
    Human chromosome 9: entries, gene names and cross-references to MIM
  2. SIMILARITY comments
    Index of protein domains and families
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again