Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Sperm-associated antigen 8

Gene

SPAG8

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Plays a role in spermatogenesis by enhancing the binding of CREM isoform tau to its coactivator FHL5 and increasing the FHL5-regulated transcriptional activation of CREM isoform tau (By similarity). Involved in the acrosome reaction and in binding of sperm to the zona pellucida (By similarity). Plays a role in regulation of the cell cycle by controlling progression through the G2/M phase, possibly by delaying the activation of CDK1 which is required for entry into mitosis (PubMed:19548270). May play a role in fertility and microtubule formation through interaction with RANBP9 (PubMed:10500252).By similarity2 Publications

GO - Molecular functioni

GO - Biological processi

Keywordsi

Biological processCell cycle, Differentiation, Fertilization, Spermatogenesis

Names & Taxonomyi

Protein namesi
Recommended name:
Sperm-associated antigen 8
Alternative name(s):
HSD-1
Sperm membrane protein 1
Short name:
SMP-1
Sperm membrane protein BS-84
Gene namesi
Name:SPAG8
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 9

Organism-specific databases

EuPathDBiHostDB:ENSG00000137098.13
HGNCiHGNC:14105 SPAG8
MIMi605731 gene
neXtProtiNX_Q99932

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Cytoplasmic vesicle, Cytoskeleton, Nucleus

Pathology & Biotechi

Organism-specific databases

DisGeNETi26206
OpenTargetsiENSG00000137098
PharmGKBiPA37843

Polymorphism and mutation databases

BioMutaiSPAG8
DMDMi62511128

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000720991 – 426Sperm-associated antigen 8Add BLAST426

Proteomic databases

PaxDbiQ99932
PeptideAtlasiQ99932
PRIDEiQ99932
ProteomicsDBi78524
78525 [Q99932-2]

PTM databases

iPTMnetiQ99932
PhosphoSitePlusiQ99932

Expressioni

Tissue specificityi

Expressed in testis (germ cells), but not in liver, kidney, prostate and small intestine.1 Publication

Gene expression databases

BgeeiENSG00000137098 Expressed in 209 organ(s), highest expression level in right uterine tube
CleanExiHS_SPAG8
ExpressionAtlasiQ99932 baseline and differential
GenevisibleiQ99932 HS

Organism-specific databases

HPAiHPA068012

Interactioni

Subunit structurei

Interacts with FHL5 (via second LIM domain) (By similarity). Interacts with RANBP9 (PubMed:15014887).By similarity1 Publication

Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

BioGridi117606, 16 interactors
IntActiQ99932, 90 interactors
MINTiQ99932
STRINGi9606.ENSP00000340982

Structurei

3D structure databases

ProteinModelPortaliQ99932
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi43 – 71Ala-richAdd BLAST29
Compositional biasi136 – 204Gly-richAdd BLAST69

Sequence similaritiesi

Belongs to the SPAG8 family.Curated

Phylogenomic databases

eggNOGiENOG410IYX0 Eukaryota
ENOG4111NK4 LUCA
GeneTreeiENSGT00640000091617
HOGENOMiHOG000294170
HOVERGENiHBG059013
InParanoidiQ99932
OMAiFRHGHQG
OrthoDBiEOG091G0GY7
PhylomeDBiQ99932
TreeFamiTF329075

Family and domain databases

InterProiView protein in InterPro
IPR026124 Sperm-assoc_Ag8
PANTHERiPTHR15510 PTHR15510, 2 hits

Sequences (3+)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 4 potential isoforms that are computationally mapped.iShow all

Isoform 1 (identifier: Q99932-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
METNESTEGS RSRSRSLDIQ PSSEGLGPTS EPFPSSDDSP RSALAAATAA
60 70 80 90 100
AAAAASAAAA TAAFTTAKAA ALSTKTPAPC SEFMEPSSDP SLLGEPCAGP
110 120 130 140 150
GFTHNIAHGS LGFEPVYVSC IAQDTCTTTD HSSNPGPVPG SSSGPVLGSS
160 170 180 190 200
SGAGHGSGSG SGPGCGSVPG SGSGPGPGSG PGSGPGHGSG SHPGPASGPG
210 220 230 240 250
PDTGPDSELS PCIPPGFRNL VADRVPNYTS WSQHCPWEPQ KQPPWEFLQV
260 270 280 290 300
LEPGARGLWK PPDIKGKLMV CYETLPRGQC LLYNWEEERA TNHLDQVPSM
310 320 330 340 350
QDGSESFFFR HGHRGLLTMQ LKSPMPSSTT QKDSYQPPGN VYWPLRGKRE
360 370 380 390 400
AMLEMLLQHQ ICKEVQAEQE PTRKLFEVES VTHHDYRMEL AQAGTPAPTK
410 420
PHDYRQEQPE TFWIQRAPQL PVCEGD
Length:426
Mass (Da):44,819
Last modified:April 12, 2005 - v2
Checksum:i7CFF3447202CA270
GO
Isoform 2 (identifier: Q99932-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     422-426: VCEGD → TWWPLPTQVP...KTVTQEDRGW

Note: No experimental confirmation available.
Show »
Length:501
Mass (Da):53,507
Checksum:iF7A14ED49DF6CE03
GO
Isoform 3 (identifier: Q99932-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     422-426: VCEGD → GVSNIRTLDTPFRKNCSFSTPVPLSLGKLLPYEPENYPYQLGEISSLPCPGGRLGGGGGRMTPF

Note: No experimental confirmation available.Curated
Show »
Length:485
Mass (Da):51,139
Checksum:i206A2AE68C5A4887
GO

Computationally mapped potential isoform sequencesi

There are 4 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
C9JAA8C9JAA8_HUMAN
Sperm-associated antigen 8
SPAG8
477Annotation score:
F8WBP3F8WBP3_HUMAN
Sperm-associated antigen 8
SPAG8
96Annotation score:
H7C4J6H7C4J6_HUMAN
Sperm-associated antigen 8
SPAG8
483Annotation score:
F2Z302F2Z302_HUMAN
Sperm-associated antigen 8
SPAG8
69Annotation score:

Sequence cautioni

The sequence AAB46833 differs from that shown. Reason: Erroneous termination at position 427. Translated as stop.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti5E → G in AAH19247 (PubMed:15489334).Curated1
Sequence conflicti48T → A in BAG63651 (PubMed:14702039).Curated1
Sequence conflicti49A → S in AAB46833 (PubMed:8788182).Curated1
Sequence conflicti176 – 179Missing in BAG63651 (PubMed:14702039).Curated4
Sequence conflicti269M → Q in AAB46833 (PubMed:8788182).Curated1
Sequence conflicti322K → T in AAB46833 (PubMed:8788182).Curated1
Isoform 3 (identifier: Q99932-3)
Sequence conflicti438S → G in BAG63651 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_05699269A → T. Corresponds to variant dbSNP:rs13299596Ensembl.1
Natural variantiVAR_069166226P → L1 PublicationCorresponds to variant dbSNP:rs17851728Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_013274422 – 426VCEGD → TWWPLPTQVPAAEDYLTWKE WGFTGVQEVLSALLRATPGE YSVNICGMNEHPVCSRTWTN RLCHQEMGSKKTVTQEDRGW in isoform 2. 1 Publication5
Alternative sequenceiVSP_046325422 – 426VCEGD → GVSNIRTLDTPFRKNCSFST PVPLSLGKLLPYEPENYPYQ LGEISSLPCPGGRLGGGGGR MTPF in isoform 3. 1 Publication5

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
S83157 mRNA Translation: AAB46833.1 Sequence problems.
U12978 mRNA Translation: AAA21129.2
AK302313 mRNA Translation: BAG63651.1
AL133410 Genomic DNA No translation available.
BC019247 mRNA Translation: AAH19247.1
CCDSiCCDS43798.1 [Q99932-3]
CCDS6592.1 [Q99932-2]
RefSeqiNP_001034681.1, NM_001039592.1 [Q99932-3]
NP_758516.1, NM_172312.1 [Q99932-2]
UniGeneiHs.256747

Genome annotation databases

EnsembliENST00000340291; ENSP00000340982; ENSG00000137098 [Q99932-2]
ENST00000396638; ENSP00000379878; ENSG00000137098 [Q99932-3]
ENST00000475644; ENSP00000418530; ENSG00000137098 [Q99932-1]
GeneIDi26206
KEGGihsa:26206
UCSCiuc003zye.4 human [Q99932-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiSPAG8_HUMAN
AccessioniPrimary (citable) accession number: Q99932
Secondary accession number(s): B4DY89
, E9PDV6, Q12937, Q5TCV8, Q8WWB4
Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 12, 2005
Last sequence update: April 12, 2005
Last modified: September 12, 2018
This is version 132 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again