Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Protein SSX3

Gene

SSX3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Could act as a modulator of transcription.

GO - Molecular functioni

GO - Biological processi

Keywordsi

Biological processTranscription, Transcription regulation

Names & Taxonomyi

Protein namesi
Recommended name:
Protein SSX3
Alternative name(s):
Cancer/testis antigen 5.3
Short name:
CT5.3
Gene namesi
Name:SSX3
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome X

Organism-specific databases

EuPathDBiHostDB:ENSG00000165584.15
HGNCiHGNC:11337 SSX3
MIMi300325 gene
neXtProtiNX_Q99909

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000165584
PharmGKBiPA36161

Polymorphism and mutation databases

DMDMi84028266

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001818301 – 188Protein SSX3Add BLAST188

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei123PhosphoserineBy similarity1

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDbiQ99909
PeptideAtlasiQ99909
PRIDEiQ99909
ProteomicsDBi78520
78521 [Q99909-2]

PTM databases

iPTMnetiQ99909
PhosphoSitePlusiQ99909

Expressioni

Gene expression databases

BgeeiENSG00000165584
CleanExiHS_SSX3
ExpressionAtlasiQ99909 baseline and differential
GenevisibleiQ99909 HS

Organism-specific databases

HPAiHPA045683

Interactioni

Subunit structurei

Interacts with SSX2IP.1 Publication

Binary interactionsi

Show more details

Protein-protein interaction databases

BioGridi115509, 22 interactors
IntActiQ99909, 17 interactors
STRINGi9606.ENSP00000298396

Structurei

3D structure databases

ProteinModelPortaliQ99909
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini20 – 83KRAB-relatedPROSITE-ProRule annotationAdd BLAST64

Sequence similaritiesi

Belongs to the SSX family.Curated

Phylogenomic databases

eggNOGiENOG410JCMU Eukaryota
ENOG4111A52 LUCA
GeneTreeiENSGT00390000012484
HOGENOMiHOG000231461
HOVERGENiHBG002056
InParanoidiQ99909
OMAiINMISGP
PhylomeDBiQ99909
TreeFamiTF338517

Family and domain databases

CDDicd07765 KRAB_A-box, 1 hit
InterProiView protein in InterPro
IPR001909 KRAB
IPR036051 KRAB_dom_sf
IPR003655 Krueppel-associated_box-rel
IPR028804 SSX
IPR019041 SSXRD_motif
PANTHERiPTHR14112 PTHR14112, 1 hit
PfamiView protein in Pfam
PF09514 SSXRD, 1 hit
SMARTiView protein in SMART
SM00349 KRAB, 1 hit
SUPFAMiSSF109640 SSF109640, 1 hit
PROSITEiView protein in PROSITE
PS50806 KRAB_RELATED, 1 hit

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q99909-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MNGDDTFARR PTVGAQIPEK IQKAFDDIAK YFSKEEWEKM KVSEKIVYVY
60 70 80 90 100
MKRKYEAMTK LGFKAILPSF MRNKRVTDFQ GNDFDNDPNR GNQVQRPQMT
110 120 130 140 150
FGRLQGIFPK IMPKKPAEEG NVSKEVPEAS GPQNDGKQLC PPGKPTTSEK
160 170 180
INMISGPKRG EHAWTHRLRE RKQLVIYEEI SDPEEDDE
Length:188
Mass (Da):21,697
Last modified:December 20, 2005 - v2
Checksum:i988294793159C36E
GO
Isoform 2 (identifier: Q99909-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     157-188: PKRGEHAWTHRLRERKQLVIYEEISDPEEDDE → VLQRYCRFGSRPLQ

Note: No experimental confirmation available.
Show »
Length:170
Mass (Da):19,457
Checksum:iD981F807A9C7EAB1
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti95Q → L in AAB37436 (PubMed:8697803).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_042777157 – 188PKRGE…EEDDE → VLQRYCRFGSRPLQ in isoform 2. 1 PublicationAdd BLAST32

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
S82471 mRNA Translation: AAB37436.2
U90840 mRNA Translation: AAC05819.1
AL606490 Genomic DNA No translation available.
CH471164 Genomic DNA Translation: EAW59347.1
BC005904 mRNA Translation: AAH05904.1
BC103862 mRNA Translation: AAI03863.1
CCDSiCCDS14291.1 [Q99909-1]
RefSeqiNP_066294.1, NM_021014.3 [Q99909-1]
XP_011542187.1, XM_011543885.2 [Q99909-2]
UniGeneiHs.558445

Genome annotation databases

EnsembliENST00000298396; ENSP00000298396; ENSG00000165584 [Q99909-1]
ENST00000376893; ENSP00000366090; ENSG00000165584 [Q99909-2]
GeneIDi10214
KEGGihsa:10214
UCSCiuc004djd.3 human [Q99909-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiSSX3_HUMAN
AccessioniPrimary (citable) accession number: Q99909
Secondary accession number(s): O60223, Q5JQZ3, Q9BRW7
Entry historyiIntegrated into UniProtKB/Swiss-Prot: December 15, 1998
Last sequence update: December 20, 2005
Last modified: July 18, 2018
This is version 145 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome X
    Human chromosome X: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health