Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 160 (07 Oct 2020)
Sequence version 3 (07 Jul 2009)
Previous versions | rss
Add a publicationFeedback
Protein

HAUS augmin-like complex subunit 7

Gene

HAUS7

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Contributes to mitotic spindle assembly, maintenance of centrosome integrity and completion of cytokinesis as part of the HAUS augmin-like complex.2 Publications

Caution

It is uncertain whether Met-1 or Met-11 is the initiator.Curated

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processCell cycle, Cell division, Mitosis

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...
PathwayCommonsi
Q99871

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-2565942, Regulation of PLK1 Activity at G2/M Transition
R-HSA-380259, Loss of Nlp from mitotic centrosomes
R-HSA-380270, Recruitment of mitotic centrosome proteins and complexes
R-HSA-380284, Loss of proteins required for interphase microtubule organization from the centrosome
R-HSA-380320, Recruitment of NuMA to mitotic centrosomes
R-HSA-5620912, Anchoring of the basal body to the plasma membrane
R-HSA-8854518, AURKA Activation by TPX2

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
HAUS augmin-like complex subunit 7
Alternative name(s):
26S proteasome-associated UCH37-interacting protein 1
UCHL5-interacting protein
X-linked protein STS1769
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:HAUS7
Synonyms:UCHL5IP, UIP1
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome X

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000213397.10

Human Gene Nomenclature Database

More...
HGNCi
HGNC:32979, HAUS7

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
300540, gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q99871

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Cytoskeleton, Microtubule

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
55559

Open Targets

More...
OpenTargetsi
ENSG00000213397

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA165756645

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q99871, Tbio

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
HAUS7

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000975521 – 368HAUS augmin-like complex subunit 7Add BLAST368

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei26PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q99871

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q99871

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q99871

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q99871

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q99871

PeptideAtlas

More...
PeptideAtlasi
Q99871

PRoteomics IDEntifications database

More...
PRIDEi
Q99871

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
78508 [Q99871-1]
78509 [Q99871-2]
78510 [Q99871-3]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q99871

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q99871

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Detected in spleen, thymus, testis, ovary, small intestine and colon, with highest levels of expression in testis and ovary.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000213397, Expressed in tibial artery and 113 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q99871, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q99871, HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
ENSG00000213397, Low tissue specificity

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Component of the HAUS augmin-like complex. The complex interacts with the gamma-tubulin ring complex and this interaction is required for spindle assembly. Binds UCHL5.

3 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
120718, 93 interactors

ComplexPortal: manually curated resource of macromolecular complexes

More...
ComplexPortali
CPX-1847, HAUS complex

CORUM comprehensive resource of mammalian protein complexes

More...
CORUMi
Q99871

Database of interacting proteins

More...
DIPi
DIP-32974N

Protein interaction database and analysis system

More...
IntActi
Q99871, 72 interactors

Molecular INTeraction database

More...
MINTi
Q99871

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000359230

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q99871, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q99871

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and domains' section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili213 – 246Sequence analysisAdd BLAST34

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the HAUS7 family.Curated

Keywords - Domaini

Coiled coil

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG502RYVK, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000003937

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_065168_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q99871

KEGG Orthology (KO)

More...
KOi
K16590

Identification of Orthologs from Complete Genome Data

More...
OMAi
PESDPWP

Database of Orthologous Groups

More...
OrthoDBi
1184888at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q99871

TreeFam database of animal gene trees

More...
TreeFami
TF333445

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR029711, Haus7-like

The PANTHER Classification System

More...
PANTHERi
PTHR14352, PTHR14352, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q99871-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MGGARLGARN MAGQDAGCGR GGDDYSEDEG DSSVSRAAVE VFGKLKDLNC
60 70 80 90 100
PFLEGLYITE PKTIQELLCS PSEYRLEILE WMCTRVWPSL QDRFSSLKGV
110 120 130 140 150
PTEVKIQEMT KLGHELMLCA PDDQELLKGC ACAQKQLHFM DQLLDTIRSL
160 170 180 190 200
TIGCSSCSSL MEHFEDTREK NEALLGELFS SPHLQMLLNP ECDPWPLDMQ
210 220 230 240 250
PLLNKQSDDW QWASASAKSE EEEKLAELAR QLQESAAKLH ALRTEYFAQH
260 270 280 290 300
EQGAAAGAAD ISTLDQKLRL VTSDFHQLIL AFLQVYDDEL GECCQRPGPD
310 320 330 340 350
LHPCGPIIQA THQNLTSYSQ LLQVVMAVAD TSAKAVETVK KQQGEQICWG
360
GSSSVMSLAT KMNELMEK
Length:368
Mass (Da):40,778
Last modified:July 7, 2009 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i15E9A47D741DB26B
GO
Isoform 2 (identifier: Q99871-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     320-320: Q → QIPRGQPKKPALVTMTTVPTCATLPLAQGFRDVHFGFLSERLRAFQPLTGWSCETPRSGM

Show »
Length:427
Mass (Da):47,262
Checksum:iA46960622889427B
GO
Isoform 3 (identifier: Q99871-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     321-339: LLQVVMAVADTSAKAVETV → VRVPFPSPLTAPSPVHSD
     340-368: Missing.

Show »
Length:338
Mass (Da):37,524
Checksum:i796EC5EC818C9F62
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H7BZF8H7BZF8_HUMAN
HAUS augmin-like complex subunit 7
HAUS7
211Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A6NDA1A6NDA1_HUMAN
HAUS augmin-like complex subunit 7
HAUS7
127Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAF75785 differs from that shown. Reason: Erroneous initiation. Truncated N-terminus.Curated
The sequence BAG62338 differs from that shown. Reason: Erroneous initiation. Truncated N-terminus.Curated
The sequence CAA67665 differs from that shown. Chimera. The N-terminal part of the clone up to position 91 maps to another chromosome.Curated
The sequence CAA67665 differs from that shown. Reason: Frameshift.Curated

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_037669320Q → QIPRGQPKKPALVTMTTVPT CATLPLAQGFRDVHFGFLSE RLRAFQPLTGWSCETPRSGM in isoform 2. 1 Publication1
Alternative sequenceiVSP_040920321 – 339LLQVV…AVETV → VRVPFPSPLTAPSPVHSD in isoform 3. 2 PublicationsAdd BLAST19
Alternative sequenceiVSP_040921340 – 368Missing in isoform 3. 2 PublicationsAdd BLAST29

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
U82695 Genomic DNA No translation available.
CH471172 Genomic DNA Translation: EAW72866.1
CH471172 Genomic DNA Translation: EAW72868.1
CH471172 Genomic DNA Translation: EAW72869.1
CH471172 Genomic DNA Translation: EAW72871.1
BC008141 mRNA Translation: AAH08141.3
CA441020 mRNA No translation available.
AK300650 mRNA Translation: BAG62338.1 Different initiation.
AF267739 mRNA Translation: AAF75785.1 Different initiation.
X99270 mRNA Translation: CAA67665.1 Sequence problems.
AL122036 mRNA Translation: CAB59176.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS35438.1 [Q99871-1]

Protein sequence database of the Protein Information Resource

More...
PIRi
T34551

NCBI Reference Sequences

More...
RefSeqi
NP_059988.3, NM_017518.7 [Q99871-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000370211; ENSP00000359230; ENSG00000213397 [Q99871-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
55559

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:55559

UCSC genome browser

More...
UCSCi
uc004fho.3, human [Q99871-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U82695 Genomic DNA No translation available.
CH471172 Genomic DNA Translation: EAW72866.1
CH471172 Genomic DNA Translation: EAW72868.1
CH471172 Genomic DNA Translation: EAW72869.1
CH471172 Genomic DNA Translation: EAW72871.1
BC008141 mRNA Translation: AAH08141.3
CA441020 mRNA No translation available.
AK300650 mRNA Translation: BAG62338.1 Different initiation.
AF267739 mRNA Translation: AAF75785.1 Different initiation.
X99270 mRNA Translation: CAA67665.1 Sequence problems.
AL122036 mRNA Translation: CAB59176.1
CCDSiCCDS35438.1 [Q99871-1]
PIRiT34551
RefSeqiNP_059988.3, NM_017518.7 [Q99871-1]

3D structure databases

SMRiQ99871
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi120718, 93 interactors
ComplexPortaliCPX-1847, HAUS complex
CORUMiQ99871
DIPiDIP-32974N
IntActiQ99871, 72 interactors
MINTiQ99871
STRINGi9606.ENSP00000359230

PTM databases

iPTMnetiQ99871
PhosphoSitePlusiQ99871

Polymorphism and mutation databases

BioMutaiHAUS7

Proteomic databases

EPDiQ99871
jPOSTiQ99871
MassIVEiQ99871
MaxQBiQ99871
PaxDbiQ99871
PeptideAtlasiQ99871
PRIDEiQ99871
ProteomicsDBi78508 [Q99871-1]
78509 [Q99871-2]
78510 [Q99871-3]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
461, 278 antibodies

Genome annotation databases

EnsembliENST00000370211; ENSP00000359230; ENSG00000213397 [Q99871-1]
GeneIDi55559
KEGGihsa:55559
UCSCiuc004fho.3, human [Q99871-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
55559
DisGeNETi55559
EuPathDBiHostDB:ENSG00000213397.10

GeneCards: human genes, protein and diseases

More...
GeneCardsi
HAUS7
HGNCiHGNC:32979, HAUS7
HPAiENSG00000213397, Low tissue specificity
MIMi300540, gene
neXtProtiNX_Q99871
OpenTargetsiENSG00000213397
PharmGKBiPA165756645

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG502RYVK, Eukaryota
GeneTreeiENSGT00390000003937
HOGENOMiCLU_065168_0_0_1
InParanoidiQ99871
KOiK16590
OMAiPESDPWP
OrthoDBi1184888at2759
PhylomeDBiQ99871
TreeFamiTF333445

Enzyme and pathway databases

PathwayCommonsiQ99871
ReactomeiR-HSA-2565942, Regulation of PLK1 Activity at G2/M Transition
R-HSA-380259, Loss of Nlp from mitotic centrosomes
R-HSA-380270, Recruitment of mitotic centrosome proteins and complexes
R-HSA-380284, Loss of proteins required for interphase microtubule organization from the centrosome
R-HSA-380320, Recruitment of NuMA to mitotic centrosomes
R-HSA-5620912, Anchoring of the basal body to the plasma membrane
R-HSA-8854518, AURKA Activation by TPX2

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
55559, 340 hits in 488 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
HAUS7, human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
55559
PharosiQ99871, Tbio

Protein Ontology

More...
PROi
PR:Q99871
RNActiQ99871, protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000213397, Expressed in tibial artery and 113 other tissues
ExpressionAtlasiQ99871, baseline and differential
GenevisibleiQ99871, HS

Family and domain databases

InterProiView protein in InterPro
IPR029711, Haus7-like
PANTHERiPTHR14352, PTHR14352, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiHAUS7_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q99871
Secondary accession number(s): B4DUH6
, D3DWT9, Q96HS8, Q9NP54, Q9UFH9
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: July 7, 2009
Last modified: October 7, 2020
This is version 160 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families
  3. Human chromosome X
    Human chromosome X: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again