Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

HAUS augmin-like complex subunit 7

Gene

HAUS7

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Contributes to mitotic spindle assembly, maintenance of centrosome integrity and completion of cytokinesis as part of the HAUS augmin-like complex.2 Publications

Caution

The gene for this protein is either identical to or adjacent to that of TREX2. Most mRNAs that encode UCHL5IP also include the N-terminal part of TREX2.Curated
It is uncertain whether Met-1 or Met-11 is the initiator.Curated

GO - Molecular functioni

  • thioesterase binding Source: UniProtKB

GO - Biological processi

  • cell division Source: UniProtKB-KW
  • centrosome cycle Source: UniProtKB
  • ciliary basal body-plasma membrane docking Source: Reactome
  • G2/M transition of mitotic cell cycle Source: Reactome
  • regulation of G2/M transition of mitotic cell cycle Source: Reactome
  • spindle assembly Source: UniProtKB

Keywordsi

Biological processCell cycle, Cell division, Mitosis

Enzyme and pathway databases

ReactomeiR-HSA-2565942 Regulation of PLK1 Activity at G2/M Transition
R-HSA-380259 Loss of Nlp from mitotic centrosomes
R-HSA-380270 Recruitment of mitotic centrosome proteins and complexes
R-HSA-380284 Loss of proteins required for interphase microtubule organization from the centrosome
R-HSA-380320 Recruitment of NuMA to mitotic centrosomes
R-HSA-5620912 Anchoring of the basal body to the plasma membrane
R-HSA-8854518 AURKA Activation by TPX2

Names & Taxonomyi

Protein namesi
Recommended name:
HAUS augmin-like complex subunit 7
Alternative name(s):
26S proteasome-associated UCH37-interacting protein 1
UCHL5-interacting protein
X-linked protein STS1769
Gene namesi
Name:HAUS7
Synonyms:UCHL5IP, UIP1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome X

Organism-specific databases

EuPathDBiHostDB:ENSG00000213397.10
HGNCiHGNC:32979 HAUS7
MIMi300540 gene
neXtProtiNX_Q99871

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Cytoskeleton, Microtubule

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000213397
PharmGKBiPA165756645

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000975521 – 368HAUS augmin-like complex subunit 7Add BLAST368

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei26PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ99871
MaxQBiQ99871
PaxDbiQ99871
PeptideAtlasiQ99871
PRIDEiQ99871
ProteomicsDBi78508
78509 [Q99871-2]
78510 [Q99871-3]

PTM databases

iPTMnetiQ99871
PhosphoSitePlusiQ99871

Expressioni

Tissue specificityi

Detected in spleen, thymus, testis, ovary, small intestine and colon, with highest levels of expression in testis and ovary.1 Publication

Gene expression databases

BgeeiENSG00000213397
CleanExiHS_UCHL5IP
ExpressionAtlasiQ99871 baseline and differential
GenevisibleiQ99871 HS

Organism-specific databases

HPAiHPA003614

Interactioni

Subunit structurei

Component of the HAUS augmin-like complex. The complex interacts with the gamma-tubulin ring complex and this interaction is required for spindle assembly. Binds UCHL5.3 Publications

Binary interactionsi

Show more details

GO - Molecular functioni

  • thioesterase binding Source: UniProtKB

Protein-protein interaction databases

BioGridi120718, 91 interactors
ComplexPortaliCPX-1847 HAUS complex
CORUMiQ99871
DIPiDIP-32974N
IntActiQ99871, 41 interactors
MINTiQ99871
STRINGi9606.ENSP00000359239

Structurei

3D structure databases

ProteinModelPortaliQ99871
SMRiQ99871
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili213 – 246Sequence analysisAdd BLAST34

Sequence similaritiesi

Belongs to the HAUS7 family.Curated

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiENOG410IRC4 Eukaryota
ENOG4111MKV LUCA
GeneTreeiENSGT00390000003937
HOGENOMiHOG000231508
HOVERGENiHBG074169
InParanoidiQ99871
KOiK16590
OMAiVISDFHQ
OrthoDBiEOG091G0TFM
PhylomeDBiQ99871
TreeFamiTF333445

Family and domain databases

InterProiView protein in InterPro
IPR029711 Haus7-like
PANTHERiPTHR14352 PTHR14352, 1 hit

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q99871-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MGGARLGARN MAGQDAGCGR GGDDYSEDEG DSSVSRAAVE VFGKLKDLNC
60 70 80 90 100
PFLEGLYITE PKTIQELLCS PSEYRLEILE WMCTRVWPSL QDRFSSLKGV
110 120 130 140 150
PTEVKIQEMT KLGHELMLCA PDDQELLKGC ACAQKQLHFM DQLLDTIRSL
160 170 180 190 200
TIGCSSCSSL MEHFEDTREK NEALLGELFS SPHLQMLLNP ECDPWPLDMQ
210 220 230 240 250
PLLNKQSDDW QWASASAKSE EEEKLAELAR QLQESAAKLH ALRTEYFAQH
260 270 280 290 300
EQGAAAGAAD ISTLDQKLRL VTSDFHQLIL AFLQVYDDEL GECCQRPGPD
310 320 330 340 350
LHPCGPIIQA THQNLTSYSQ LLQVVMAVAD TSAKAVETVK KQQGEQICWG
360
GSSSVMSLAT KMNELMEK
Length:368
Mass (Da):40,778
Last modified:July 7, 2009 - v3
Checksum:i15E9A47D741DB26B
GO
Isoform 2 (identifier: Q99871-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     320-320: Q → QIPRGQPKKPALVTMTTVPTCATLPLAQGFRDVHFGFLSERLRAFQPLTGWSCETPRSGM

Note: Derived from EST data.
Show »
Length:427
Mass (Da):47,262
Checksum:iA46960622889427B
GO
Isoform 3 (identifier: Q99871-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     321-339: LLQVVMAVADTSAKAVETV → VRVPFPSPLTAPSPVHSD
     340-368: Missing.

Note: No experimental confirmation available.
Show »
Length:338
Mass (Da):37,524
Checksum:i796EC5EC818C9F62
GO

Sequence cautioni

The sequence AAF75785 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence BAG62338 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence CAA67665 differs from that shown. Chimera. The N-terminal part of the clone up to position 91 maps to another chromosome.Curated
The sequence CAA67665 differs from that shown. Reason: Frameshift at positions 258 and 260.Curated

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_037669320Q → QIPRGQPKKPALVTMTTVPT CATLPLAQGFRDVHFGFLSE RLRAFQPLTGWSCETPRSGM in isoform 2. 1 Publication1
Alternative sequenceiVSP_040920321 – 339LLQVV…AVETV → VRVPFPSPLTAPSPVHSD in isoform 3. 2 PublicationsAdd BLAST19
Alternative sequenceiVSP_040921340 – 368Missing in isoform 3. 2 PublicationsAdd BLAST29

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U82695 Genomic DNA No translation available.
CH471172 Genomic DNA Translation: EAW72866.1
CH471172 Genomic DNA Translation: EAW72868.1
CH471172 Genomic DNA Translation: EAW72869.1
CH471172 Genomic DNA Translation: EAW72871.1
BC008141 mRNA Translation: AAH08141.3
CA441020 mRNA No translation available.
AK300650 mRNA Translation: BAG62338.1 Different initiation.
AF267739 mRNA Translation: AAF75785.1 Different initiation.
X99270 mRNA Translation: CAA67665.1 Sequence problems.
AL122036 mRNA Translation: CAB59176.1
CCDSiCCDS35438.1 [Q99871-1]
PIRiT34551
RefSeqiNP_059988.3, NM_017518.7 [Q99871-1]
UniGeneiHs.170835
Hs.743822

Genome annotation databases

EnsembliENST00000370211; ENSP00000359230; ENSG00000213397 [Q99871-1]
GeneIDi55559
KEGGihsa:55559
UCSCiuc004fho.3 human [Q99871-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiHAUS7_HUMAN
AccessioniPrimary (citable) accession number: Q99871
Secondary accession number(s): B4DUH6
, D3DWT9, Q96HS8, Q9NP54, Q9UFH9
Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: July 7, 2009
Last modified: June 20, 2018
This is version 143 of the entry and version 3 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome X
    Human chromosome X: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health