Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Noelin

Gene

OLFM1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Contributes to the regulation of axonal growth in the embryonic and adult central nervous system by inhibiting interactions between RTN4R and LINGO1. Inhibits RTN4R-mediated axon growth cone collapse (By similarity). May play an important role in regulating the production of neural crest cells by the neural tube (By similarity). May be required for normal responses to olfactory stimuli (By similarity).By similarity

GO - Biological processi

Keywordsi

Molecular functionDevelopmental protein

Names & Taxonomyi

Protein namesi
Recommended name:
Noelin
Alternative name(s):
Neuronal olfactomedin-related ER localized protein
Olfactomedin-1
Gene namesi
Name:OLFM1
Synonyms:NOE1, NOEL1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 9

Organism-specific databases

EuPathDBiHostDB:ENSG00000130558.18
HGNCiHGNC:17187 OLFM1
MIMi605366 gene
neXtProtiNX_Q99784

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell junction, Cell projection, Endoplasmic reticulum, Secreted, Synapse

Pathology & Biotechi

Organism-specific databases

DisGeNETi10439
OpenTargetsiENSG00000130558
PharmGKBiPA31915

Polymorphism and mutation databases

DMDMi206729935

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 16Sequence analysisAdd BLAST16
ChainiPRO_000002007417 – 485NoelinAdd BLAST469

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Glycosylationi33N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi103N-linked (GlcNAc...) asparagine1 Publication1
Glycosylationi187N-linked (GlcNAc...) asparagine1 Publication1
Disulfide bondi221InterchainBy similarity
Disulfide bondi227 ↔ 409PROSITE-ProRule annotationBy similarity
Glycosylationi288N-linked (GlcNAc...) asparagine1 Publication1
Glycosylationi307N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi394N-linked (GlcNAc...) asparagine1 Publication1
Glycosylationi431N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi473N-linked (GlcNAc...) asparagineSequence analysis1

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

MaxQBiQ99784
PaxDbiQ99784
PeptideAtlasiQ99784
PRIDEiQ99784
ProteomicsDBi78470
78471 [Q99784-2]
78472 [Q99784-3]
78473 [Q99784-4]

PTM databases

iPTMnetiQ99784
PhosphoSitePlusiQ99784

Expressioni

Gene expression databases

BgeeiENSG00000130558 Expressed in 209 organ(s), highest expression level in anterior cingulate cortex
CleanExiHS_OLFM1
ExpressionAtlasiQ99784 baseline and differential
GenevisibleiQ99784 HS

Organism-specific databases

HPAiHPA057444

Interactioni

Subunit structurei

Homotetramer; disulfide-linked. Dimer of dimers, giving rise to a V-shaped homotretramer. Isoform 1 and isoform 3 interact with RTN4R. Identified in a complex with RTN4R and LINGO1. Peripherally associated with AMPAR complex. AMPAR complex consists of an inner core made of 4 pore-forming GluA/GRIA proteins (GRIA1, GRIA2, GRIA3 and GRIA4) and 4 major auxiliary subunits arranged in a twofold symmetry. One of the two pairs of distinct binding sites is occupied either by CNIH2, CNIH3 or CACNG2, CACNG3. The other harbors CACNG2, CACNG3, CACNG4, CACNG8 or GSG1L. This inner core of AMPAR complex is complemented by outer core constituents binding directly to the GluA/GRIA proteins at sites distinct from the interaction sites of the inner core constituents. Outer core constituents include at least PRRT1, PRRT2, CKAMP44/SHISA9, FRRS1L and NRN1. The proteins of the inner and outer core serve as a platform for other, more peripherally associated AMPAR constituents, including OLFM1. Alone or in combination, these auxiliary subunits control the gating and pharmacology of the AMPAR complex and profoundly impact their biogenesis and protein processing (By similarity). Interacts with OLFM2 (PubMed:21228389).By similarity1 Publication

Binary interactionsi

WithEntry#Exp.IntActNotes
DISC1Q9NRI53EBI-1105073,EBI-529989

Protein-protein interaction databases

BioGridi115706, 13 interactors
IntActiQ99784, 5 interactors
STRINGi9606.ENSP00000252854

Structurei

Secondary structure

1485
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

ProteinModelPortaliQ99784
SMRiQ99784
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini226 – 478Olfactomedin-likePROSITE-ProRule annotationAdd BLAST253

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili87 – 225Sequence analysisAdd BLAST139

Domaini

The protein contains a globular N-terminal tetramerization domain, a long stalk formed by the coiled coil region and a C-terminal olfactomedin-like domain. Interactions between dimers are mediated by the coiled coil region. The dimers interact mostly via the N-terminal tetramerization domain, giving rise to a V-shaped overall architecture of the tetramer.By similarity

Keywords - Domaini

Coiled coil, Signal

Phylogenomic databases

eggNOGiENOG410INP5 Eukaryota
ENOG41100WH LUCA
GeneTreeiENSGT00760000119005
HOGENOMiHOG000232069
HOVERGENiHBG006513
InParanoidiQ99784
OMAiFNNAYHY
OrthoDBiEOG091G05HN
PhylomeDBiQ99784
TreeFamiTF315964

Family and domain databases

InterProiView protein in InterPro
IPR031217 Noelin
IPR022082 Noelin_dom
IPR003112 Olfac-like_dom
IPR011044 Quino_amine_DH_bsu
PANTHERiPTHR23192:SF34 PTHR23192:SF34, 1 hit
PfamiView protein in Pfam
PF12308 Noelin-1, 1 hit
PF02191 OLF, 1 hit
SMARTiView protein in SMART
SM00284 OLF, 1 hit
SUPFAMiSSF50969 SSF50969, 1 hit
PROSITEiView protein in PROSITE
PS00014 ER_TARGET, 1 hit
PS51132 OLF, 1 hit

Sequences (5+)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket
Note: Experimental confirmation may be lacking for some isoforms.

This entry has 5 described isoforms and 6 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q99784-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSVPLLKIGV VLSTMAMITN WMSQTLPSLV GLNTTKLSAA GGGTLDRSTG
60 70 80 90 100
VLPTNPEESW QVYSSAQDSE GRCICTVVAP QQTMCSRDAR TKQLRQLLEK
110 120 130 140 150
VQNMSQSIEV LDRRTQRDLQ YVEKMENQMK GLESKFKQVE ESHKQHLARQ
160 170 180 190 200
FKAIKAKMDE LRPLIPVLEE YKADAKLVLQ FKEEVQNLTS VLNELQEEIG
210 220 230 240 250
AYDYDELQSR VSNLEERLRA CMQKLACGKL TGISDPVTVK TSGSRFGSWM
260 270 280 290 300
TDPLAPEGDN RVWYMDGYHN NRFVREYKSM VDFMNTDNFT SHRLPHPWSG
310 320 330 340 350
TGQVVYNGSI YFNKFQSHII IRFDLKTETI LKTRSLDYAG YNNMYHYAWG
360 370 380 390 400
GHSDIDLMVD ESGLWAVYAT NQNAGNIVVS RLDPVSLQTL QTWNTSYPKR
410 420 430 440 450
SAGEAFIICG TLYVTNGYSG GTKVHYAYQT NASTYEYIDI PFQNKYSHIS
460 470 480
MLDYNPKDRA LYAWNNGHQI LYNVTLFHVI RSDEL
Length:485
Mass (Da):55,343
Last modified:September 23, 2008 - v4
Checksum:iD94BBDDAC60CF674
GO
Isoform 2 (identifier: Q99784-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     153-153: A → G
     154-485: Missing.

Show »
Length:153
Mass (Da):17,160
Checksum:i3B18DC0207992A74
GO
Isoform 3 (identifier: Q99784-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-50: MSVPLLKIGV...GGGTLDRSTG → MPGRWRWQRDMHPARKLLSLLFLILMGTELTQ

Show »
Length:467
Mass (Da):54,117
Checksum:i93D8EA9AD73562B6
GO
Isoform 4 (identifier: Q99784-4) [UniParc]FASTAAdd to basket
Also known as: AMY

The sequence of this isoform differs from the canonical sequence as follows:
     1-50: MSVPLLKIGV...GGGTLDRSTG → MPGRWRWQRDMHPARKLLSLLFLILMGTELTQ
     153-153: A → G
     154-485: Missing.

Show »
Length:135
Mass (Da):15,934
Checksum:i8F6A30B160351055
GO
Isoform 5 (identifier: Q99784-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-50: MSVPLLKIGVVLSTMAMITNWMSQTLPSLVGLNTTKLSAAGGGTLDRSTG → MGEAPGREGRGPCPQLESPRRRR

Note: No experimental confirmation available.
Show »
Length:458
Mass (Da):52,815
Checksum:iDFD8A706766D5244
GO

Computationally mapped potential isoform sequencesi

There are 6 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
F5H810F5H810_HUMAN
Noelin
OLFM1
208Annotation score:
F5GZQ2F5GZQ2_HUMAN
Noelin
OLFM1
129Annotation score:
F8W870F8W870_HUMAN
Noelin
OLFM1
163Annotation score:
H0YFB9H0YFB9_HUMAN
Noelin
OLFM1
99Annotation score:
Q6IMJ6Q6IMJ6_HUMAN
NOELIN1_V5
OLFM1
167Annotation score:
Q5VZL8Q5VZL8_HUMAN
Noelin
OLFM1
129Annotation score:

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti127N → T in BAC04756 (PubMed:14702039).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0037591 – 50MSVPL…DRSTG → MPGRWRWQRDMHPARKLLSL LFLILMGTELTQ in isoform 3 and isoform 4. 3 PublicationsAdd BLAST50
Alternative sequenceiVSP_0556251 – 50MSVPL…DRSTG → MGEAPGREGRGPCPQLESPR RRR in isoform 5. 1 PublicationAdd BLAST50
Alternative sequenceiVSP_003760153A → G in isoform 2 and isoform 4. 1 Publication1
Alternative sequenceiVSP_003761154 – 485Missing in isoform 2 and isoform 4. 1 PublicationAdd BLAST332

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
D82343 mRNA Translation: BAA11554.1
AK096304 mRNA Translation: BAC04756.1
AK290478 mRNA Translation: BAF83167.1
AL159992 Genomic DNA No translation available.
AL390778 Genomic DNA No translation available.
BC008763 mRNA Translation: AAH08763.2
BC011741 mRNA Translation: AAH11741.2
BT007146 mRNA Translation: AAP35810.1
U79299 mRNA Translation: AAB50225.1
AF035301 mRNA Translation: AAB88184.1
BK001427 Genomic DNA Translation: DAA01546.1
BK001427 Genomic DNA Translation: DAA01547.1
CCDSiCCDS65183.1 [Q99784-5]
CCDS65184.1 [Q99784-1]
CCDS6986.1 [Q99784-3]
CCDS6987.1 [Q99784-4]
PIRiJC5272
RefSeqiNP_001269540.1, NM_001282611.1 [Q99784-1]
NP_001269541.1, NM_001282612.1 [Q99784-5]
NP_006325.1, NM_006334.3 [Q99784-4]
NP_055094.1, NM_014279.4 [Q99784-3]
UniGeneiHs.522484

Genome annotation databases

EnsembliENST00000252854; ENSP00000252854; ENSG00000130558 [Q99784-3]
ENST00000277415; ENSP00000277415; ENSG00000130558 [Q99784-4]
ENST00000371793; ENSP00000360858; ENSG00000130558 [Q99784-1]
ENST00000371796; ENSP00000360861; ENSG00000130558 [Q99784-5]
ENST00000392991; ENSP00000376717; ENSG00000130558 [Q99784-2]
GeneIDi10439
KEGGihsa:10439
UCSCiuc004cfk.5 human [Q99784-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
D82343 mRNA Translation: BAA11554.1
AK096304 mRNA Translation: BAC04756.1
AK290478 mRNA Translation: BAF83167.1
AL159992 Genomic DNA No translation available.
AL390778 Genomic DNA No translation available.
BC008763 mRNA Translation: AAH08763.2
BC011741 mRNA Translation: AAH11741.2
BT007146 mRNA Translation: AAP35810.1
U79299 mRNA Translation: AAB50225.1
AF035301 mRNA Translation: AAB88184.1
BK001427 Genomic DNA Translation: DAA01546.1
BK001427 Genomic DNA Translation: DAA01547.1
CCDSiCCDS65183.1 [Q99784-5]
CCDS65184.1 [Q99784-1]
CCDS6986.1 [Q99784-3]
CCDS6987.1 [Q99784-4]
PIRiJC5272
RefSeqiNP_001269540.1, NM_001282611.1 [Q99784-1]
NP_001269541.1, NM_001282612.1 [Q99784-5]
NP_006325.1, NM_006334.3 [Q99784-4]
NP_055094.1, NM_014279.4 [Q99784-3]
UniGeneiHs.522484

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
4XATX-ray2.11A218-485[»]
ProteinModelPortaliQ99784
SMRiQ99784
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi115706, 13 interactors
IntActiQ99784, 5 interactors
STRINGi9606.ENSP00000252854

PTM databases

iPTMnetiQ99784
PhosphoSitePlusiQ99784

Polymorphism and mutation databases

DMDMi206729935

Proteomic databases

MaxQBiQ99784
PaxDbiQ99784
PeptideAtlasiQ99784
PRIDEiQ99784
ProteomicsDBi78470
78471 [Q99784-2]
78472 [Q99784-3]
78473 [Q99784-4]

Protocols and materials databases

DNASUi10439
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000252854; ENSP00000252854; ENSG00000130558 [Q99784-3]
ENST00000277415; ENSP00000277415; ENSG00000130558 [Q99784-4]
ENST00000371793; ENSP00000360858; ENSG00000130558 [Q99784-1]
ENST00000371796; ENSP00000360861; ENSG00000130558 [Q99784-5]
ENST00000392991; ENSP00000376717; ENSG00000130558 [Q99784-2]
GeneIDi10439
KEGGihsa:10439
UCSCiuc004cfk.5 human [Q99784-1]

Organism-specific databases

CTDi10439
DisGeNETi10439
EuPathDBiHostDB:ENSG00000130558.18
GeneCardsiOLFM1
HGNCiHGNC:17187 OLFM1
HPAiHPA057444
MIMi605366 gene
neXtProtiNX_Q99784
OpenTargetsiENSG00000130558
PharmGKBiPA31915
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410INP5 Eukaryota
ENOG41100WH LUCA
GeneTreeiENSGT00760000119005
HOGENOMiHOG000232069
HOVERGENiHBG006513
InParanoidiQ99784
OMAiFNNAYHY
OrthoDBiEOG091G05HN
PhylomeDBiQ99784
TreeFamiTF315964

Miscellaneous databases

ChiTaRSiOLFM1 human
GeneWikiiOLFM1
GenomeRNAii10439
PROiPR:Q99784
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000130558 Expressed in 209 organ(s), highest expression level in anterior cingulate cortex
CleanExiHS_OLFM1
ExpressionAtlasiQ99784 baseline and differential
GenevisibleiQ99784 HS

Family and domain databases

InterProiView protein in InterPro
IPR031217 Noelin
IPR022082 Noelin_dom
IPR003112 Olfac-like_dom
IPR011044 Quino_amine_DH_bsu
PANTHERiPTHR23192:SF34 PTHR23192:SF34, 1 hit
PfamiView protein in Pfam
PF12308 Noelin-1, 1 hit
PF02191 OLF, 1 hit
SMARTiView protein in SMART
SM00284 OLF, 1 hit
SUPFAMiSSF50969 SSF50969, 1 hit
PROSITEiView protein in PROSITE
PS00014 ER_TARGET, 1 hit
PS51132 OLF, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiNOE1_HUMAN
AccessioniPrimary (citable) accession number: Q99784
Secondary accession number(s): Q53XZ8
, Q6IMJ4, Q6IMJ5, Q8N8R0, Q969S7, Q99452
Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 15, 1998
Last sequence update: September 23, 2008
Last modified: November 7, 2018
This is version 174 of the entry and version 4 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  2. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  3. Human chromosome 9
    Human chromosome 9: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again