Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - Q99755 (PI51A_HUMAN)

Entry version 178 (02 Jun 2021)
Sequence version 1 (01 May 1997)
Previous versions | rss
Add a publicationFeedback
Protein

Phosphatidylinositol 4-phosphate 5-kinase type-1 alpha

Gene

PIP5K1A

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Catalyzes the phosphorylation of phosphatidylinositol 4-phosphate (PtdIns4P/PI4P) to form phosphatidylinositol 4,5-bisphosphate (PtdIns(4,5)P2/PIP2), a lipid second messenger that regulates several cellular processes such as signal transduction, vesicle trafficking, actin cytoskeleton dynamics, cell adhesion, and cell motility (PubMed:8955136, PubMed:21477596, PubMed:22942276).

PtdIns(4,5)P2 can directly act as a second messenger or can be utilized as a precursor to generate other second messengers: inositol 1,4,5-trisphosphate (IP3), diacylglycerol (DAG) or phosphatidylinositol-3,4,5-trisphosphate (PtdIns(3,4,5)P3/PIP3) (PubMed:19158393, PubMed:20660631).

PIP5K1A-mediated phosphorylation of PtdIns4P is the predominant pathway for PtdIns(4,5)P2 synthesis (By similarity).

Can also use phosphatidylinositol (PtdIns) as substrate in vitro (PubMed:22942276).

Together with PIP5K1C, is required for phagocytosis, both enzymes regulating different types of actin remodeling at sequential steps (By similarity).

Promotes particle ingestion by activating the WAS GTPase-binding protein that induces Arp2/3 dependent actin polymerization at the nascent phagocytic cup (By similarity).

Together with PIP5K1B, is required, after stimulation by G-protein coupled receptors, for the synthesis of IP3 that will induce stable platelet adhesion (By similarity).

Recruited to the plasma membrane by the E-cadherin/beta-catenin complex where it provides the substrate PtdIns(4,5)P2 for the production of PtdIns(3,4,5)P3, IP3 and DAG, that will mobilize internal calcium and drive keratinocyte differentiation (PubMed:19158393).

Positively regulates insulin-induced translocation of SLC2A4 to the cell membrane in adipocytes (By similarity).

Together with PIP5K1C has a role during embryogenesis (By similarity).

Independently of its catalytic activity, is required for membrane ruffling formation, actin organization and focal adhesion formation during directional cell migration by controlling integrin-induced translocation of the small GTPase RAC1 to the plasma membrane (PubMed:20660631).

Also functions in the nucleus where it acts as an activator of TUT1 adenylyltransferase activity in nuclear speckles, thereby regulating mRNA polyadenylation of a select set of mRNAs (PubMed:18288197).

By similarity6 Publications

Caution

There is confusion in the literature with phosphatidylinositol 4-phosphate 5-kinase type I nomenclature due to the fact that frequently mouse PIP5K1B is named Phosphatidylinositol 4-phosphate 5-kinase type I alpha.Curated

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes regulatory mechanisms for enzymes, transporters or microbial transcription factors, and reports the components which regulate (by activation or inhibition) the reaction.<p><a href='/help/activity_regulation' target='_top'>More...</a></p>Activity regulationi

Activated by diarachidonoyl phosphatidic acid (DAPA), when 1,2-dipalmitoyl-PI4P is used as a substrate.1 Publication

<p>This subsection of the 'Function' section describes biophysical and chemical properties, such as maximal absorption, kinetic parameters, pH dependence, redox potentials and temperature dependence.<p><a href='/help/biophysicochemical_properties' target='_top'>More...</a></p>Kineticsi

  1. KM=0.3 µM for 1-octadecanoyl-2-(5Z,8Z,11Z,14Z)-eicosatetraenoyl-sn-glycero-3-phospho-1D-myo-inositol 4-phosphate1 Publication
  2. KM=2.8 µM for 1-octadecanoyl-2-(5Z,8Z,11Z,14Z)-eicosatetraenoyl-sn-glycero-3-phospho-1D-myo-inositol 4-phosphate1 Publication
  3. KM=16 µM for 1-octadecanoyl-2-(9Z)-octadecenoyl-sn-glycero-3-phospho-1D-myo-inositol 4-phosphate1 Publication

    <p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

    Complete GO annotation on QuickGO ...

    GO - Biological processi

    Complete GO annotation on QuickGO ...

    <p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

    Molecular functionKinase, Transferase
    LigandATP-binding, Nucleotide-binding

    Enzyme and pathway databases

    BioCyc Collection of Pathway/Genome Databases

    More...    BioCyci    		MetaCyc:HS07047-MONOMER

    BRENDA Comprehensive Enzyme Information System

    More...    BRENDAi    		2.7.1.68, 2681

    Pathway Commons web resource for biological pathway data

    More...    PathwayCommonsi    		Q99755

    Reactome - a knowledgebase of biological pathways and processes

    More...    Reactomei    		R-HSA-1660499, Synthesis of PIPs at the plasma membrane
    R-HSA-6811558, PI5P, PP2A and IER3 Regulate PI3K/AKT Signaling

    SignaLink: a signaling pathway resource with multi-layered regulatory networks

    More...    SignaLinki    		Q99755

    SIGNOR Signaling Network Open Resource

    More...    SIGNORi    		Q99755

    Chemistry databases

    SwissLipids knowledge resource for lipid biology

    More...    SwissLipidsi    		SLP:000000553 [Q99755-3]
    SLP:000000554

    <p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

    <p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
    Recommended name:
    Phosphatidylinositol 4-phosphate 5-kinase type-1 alpha1 Publication (EC:2.7.1.683 Publications)
    Short name:
    PIP5K1-alpha2 Publications
    Short name:
    PtdIns(4)P-5-kinase 1 alpha1 Publication
    Alternative name(s):
    68 kDa type I phosphatidylinositol 4-phosphate 5-kinase alpha1 Publication
    Phosphatidylinositol 4-phosphate 5-kinase type I alpha1 Publication
    Short name:
    PIP5KIalpha2 Publications
    <p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
    Name:PIP5K1AImported
    <p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
    <p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
    <p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
    <p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
    • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 1

    Organism-specific databases

    Human Gene Nomenclature Database

    More...    HGNCi    		HGNC:8994, PIP5K1A

    Online Mendelian Inheritance in Man (OMIM)

    More...    MIMi    		603275, gene

    neXtProt; the human protein knowledge platform

    More...    neXtProti    		NX_Q99755

    Eukaryotic Pathogen, Vector and Host Database Resources

    More...    VEuPathDBi    		HostDB:ENSG00000143398.19

    <p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

    Keywords - Cellular componenti

    Cell membrane, Cell projection, Cytoplasm, Membrane, Nucleus

    <p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

    Mutagenesis

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the <a href="http://www.uniprot.org/manual/pathology%5Fand%5Fbiotech%5Fsection">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi215L → I: Decreased 1-phosphatidylinositol-4-phosphate 5-kinase activity with 1-octadecanoyl-2-(5Z,8Z,11Z,14Z)-eicosatetraenoyl-sn-glycero-3-phospho-1D-myo-inositol 4-phosphate (arachidonate-PtdIns4P) as substrate. Increased enzyme activation by diarachidonoyl phosphatidic acid (DAPA). No change in enzyme activation by 1-stearoyl-2-oleoyl phosphatidic acid (SOPA) or 1-stearoyl-2-arachidonoyl phosphatidic acid (SAPA). 2 Publications1
    Mutagenesisi223L → I: Decreased 1-phosphatidylinositol-4-phosphate 5-kinase activity with 1-octadecanoyl-2-(5Z,8Z,11Z,14Z)-eicosatetraenoyl-sn-glycero-3-phospho-1D-myo-inositol 4-phosphate (arachidonate-PtdIns4P) as substrate. Increased enzyme activation by diarachidonoyl phosphatidic acid (DAPA). No change in enzyme activation by 1-stearoyl-2-oleoyl phosphatidic acid (SOPA) or 1-stearoyl-2-arachidonoyl phosphatidic acid (SAPA). 1 Publication1
    Mutagenesisi322D → A: Increased enzyme activation by diarachidonoyl phosphatidic acid (DAPA). 1 Publication1
    Mutagenesisi322D → N: Does not affect targeting of RAC1 to the plasma membrane; when associated with Q-440. 1 Publication1
    Mutagenesisi440R → Q: Does not affect targeting of RAC1 to the plasma membrane; when associated with N-322. 1 Publication1

    Organism-specific databases

    DisGeNET

    More...    DisGeNETi    		8394

    Open Targets

    More...    OpenTargetsi    		ENSG00000143398

    The Pharmacogenetics and Pharmacogenomics Knowledge Base

    More...    PharmGKBi    		PA33327

    Miscellaneous databases

    Pharos NIH Druggable Genome Knowledgebase

    More...    Pharosi    		Q99755, Tbio

    Chemistry databases

    ChEMBL database of bioactive drug-like small molecules

    More...    ChEMBLi    		CHEMBL5969

    DrugCentral

    More...    DrugCentrali    		Q99755

    Genetic variation databases

    BioMuta curated single-nucleotide variation and disease association database

    More...    BioMutai    		PIP5K1A

    Domain mapping of disease mutations (DMDM)

    More...    DMDMi    		74752158

    <p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

    Molecule processing

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001854561 – 562Phosphatidylinositol 4-phosphate 5-kinase type-1 alphaAdd BLAST562

    Amino acid modifications

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section describes <strong>covalent linkages</strong> of various types formed <strong>between two proteins (interchain cross-links)</strong> or <strong>between two parts of the same protein (intrachain cross-links)</strong>, except the disulfide bonds that are annotated in the <a href="http://www.uniprot.org/manual/disulfid">'Disulfide bond'</a> subsection.<p><a href='/help/crosslnk' target='_top'>More...</a></p>Cross-linki103Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)
    <p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei486PhosphoserineCombined sources1

    Keywords - PTMi

    Isopeptide bond, Phosphoprotein, Ubl conjugation

    Proteomic databases

    Encyclopedia of Proteome Dynamics

    More...    EPDi    		Q99755

    jPOST - Japan Proteome Standard Repository/Database

    More...    jPOSTi    		Q99755

    MassIVE - Mass Spectrometry Interactive Virtual Environment

    More...    MassIVEi    		Q99755

    MaxQB - The MaxQuant DataBase

    More...    MaxQBi    		Q99755

    PaxDb, a database of protein abundance averages across all three domains of life

    More...    PaxDbi    		Q99755

    PeptideAtlas

    More...    PeptideAtlasi    		Q99755

    PRoteomics IDEntifications database

    More...    PRIDEi    		Q99755

    ProteomicsDB: a multi-organism proteome resource

    More...    ProteomicsDBi    		78458 [Q99755-1]
    78459 [Q99755-2]
    78460 [Q99755-3]
    78461 [Q99755-4]

    PTM databases

    iPTMnet integrated resource for PTMs in systems biology context

    More...    iPTMneti    		Q99755

    Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

    More...    PhosphoSitePlusi    		Q99755

    SwissPalm database of S-palmitoylation events

    More...    SwissPalmi    		Q99755

    <p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

    <p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

    Highly expressed in heart, placenta, skeletal muscle, kidney and pancreas. Detected at lower levels in brain, lung and liver.1 Publication

    Gene expression databases

    Bgee dataBase for Gene Expression Evolution

    More...    Bgeei    		ENSG00000143398, Expressed in esophagogastric junction muscularis propria and 236 other tissues

    ExpressionAtlas, Differential and Baseline Expression

    More...    ExpressionAtlasi    		Q99755, baseline and differential

    Genevisible search portal to normalized and curated expression data from Genevestigator

    More...    Genevisiblei    		Q99755, HS

    Organism-specific databases

    Human Protein Atlas

    More...    HPAi    		ENSG00000143398, Low tissue specificity

    <p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

    <p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

    Interacts with RAC1 (By similarity).

    Interacts with TUT1 (PubMed:18288197).

    Forms a complex with CDH1/E-cadherin, CTNNB1/beta-catenin and CTNND1 at the plasma membrane upon calcium stimulation (PubMed:18288197).

    Found in a ternary complex with IRS1 and DGKZ in the absence of insulin stimulation (By similarity).

    Interacts with DGKZ (PubMed:15157668).

    Interacts with PIP4K2C; the interaction inhibits PIP5K1A kinase activity (PubMed:31091439).

    By similarity3 Publications

    <p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

    Hide details

    GO - Molecular functioni

    Complete GO annotation on QuickGO ...

    Protein-protein interaction databases

    The Biological General Repository for Interaction Datasets (BioGRID)

    More...    BioGRIDi    		113983, 77 interactors

    Database of interacting proteins

    More...    DIPi    		DIP-60649N

    Protein interaction database and analysis system

    More...    IntActi    		Q99755, 38 interactors

    STRING: functional protein association networks

    More...    STRINGi    		9606.ENSP00000357883

    Chemistry databases

    BindingDB database of measured binding affinities

    More...    BindingDBi    		Q99755

    Miscellaneous databases

    RNAct, Protein-RNA interaction predictions for model organisms.

    More...    RNActi    		Q99755, protein

    <p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

    3D structure databases

    SWISS-MODEL Repository - a database of annotated 3D protein structure models

    More...    SMRi    		Q99755

    Database of comparative protein structure models

    More...    ModBasei    		Search...

    <p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini81 – 449PIPKPROSITE-ProRule annotationAdd BLAST369

    Region

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni506 – 526DisorderedSequence analysisAdd BLAST21

    Phylogenomic databases

    evolutionary genealogy of genes: Non-supervised Orthologous Groups

    More...    eggNOGi    		KOG0229, Eukaryota

    Ensembl GeneTree

    More...    GeneTreei    		ENSGT00940000154703

    The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

    More...    HOGENOMi    		CLU_004312_5_1_1

    InParanoid: Eukaryotic Ortholog Groups

    More...    InParanoidi    		Q99755

    Identification of Orthologs from Complete Genome Data

    More...    OMAi    		IGHRRID

    Database of Orthologous Groups

    More...    OrthoDBi    		1562683at2759

    Database for complete collections of gene phylogenies

    More...    PhylomeDBi    		Q99755

    TreeFam database of animal gene trees

    More...    TreeFami    		TF319618

    Family and domain databases

    Gene3D Structural and Functional Annotation of Protein Families

    More...    Gene3Di    		3.30.800.10, 1 hit
    3.30.810.10, 2 hits

    Integrated resource of protein families, domains and functional sites

    More...    InterProi    		View protein in InterPro
    IPR023610, PInositol-4-P-5-kinase
    IPR027483, PInositol-4-P-5-kinase_C
    IPR002498, PInositol-4-P-5-kinase_core
    IPR027484, PInositol-4-P-5-kinase_N

    The PANTHER Classification System

    More...    PANTHERi    		PTHR23086, PTHR23086, 1 hit

    Pfam protein domain database

    More...    Pfami    		View protein in Pfam
    PF01504, PIP5K, 1 hit

    Simple Modular Architecture Research Tool; a protein domain database

    More...    SMARTi    		View protein in SMART
    SM00330, PIPKc, 1 hit

    PROSITE; a protein domain and family database

    More...    PROSITEi    		View protein in PROSITE
    PS51455, PIPK, 1 hit

    <p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

    <p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

    This entry describes 4 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

    This entry has 4 described isoforms and 5 potential isoforms that are computationally mapped.Show allAlign All

    Isoform 1 (identifier: Q99755-1) [UniParc]FASTAAdd to basket
    Also known as: PIP5KIalpha21 Publication

    This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide
            10         20         30         40         50
    MASASSGPSS SVGFSSFDPA VPSCTLSSAA SGIKRPMASE VLEARQDSYI 
            60         70         80         90        100
    SLVPYASGMP IKKIGHRSVD SSGETTYKKT TSSALKGAIQ LGITHTVGSL 
           110        120        130        140        150
    STKPERDVLM QDFYVVESIF FPSEGSNLTP AHHYNDFRFK TYAPVAFRYF 
           160        170        180        190        200
    RELFGIRPDD YLYSLCSEPL IELCSSGASG SLFYVSSDDE FIIKTVQHKE 
           210        220        230        240        250
    AEFLQKLLPG YYMNLNQNPR TLLPKFYGLY CVQAGGKNIR IVVMNNLLPR 
           260        270        280        290        300
    SVKMHIKYDL KGSTYKRRAS QKEREKPLPT FKDLDFLQDI PDGLFLDADM 
           310        320        330        340        350
    YNALCKTLQR DCLVLQSFKI MDYSLLMSIH NIDHAQREPL SSETQYSVDT 
           360        370        380        390        400
    RRPAPQKALY STAMESIQGE ARRGGTMETD DHMGGIPARN SKGERLLLYI 
           410        420        430        440        450
    GIIDILQSYR FVKKLEHSWK ALVHDGDTVS VHRPGFYAER FQRFMCNTVF 
           460        470        480        490        500
    KKIPLKPSPS KKFRSGSSFS RRAGSSGNSC ITYQPSVSGE HKAQVTTKAE 
           510        520        530        540        550
    VEPGVHLGRP DVLPQTPPLE EISEGSPIPD PSFSPLVGET LQMLTTSTTL 
           560 
    EKLEVAESEF TH
    Length:562
    Mass (Da):62,633
    Last modified:May 1, 1997 - v1
    <p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iA8F7988EB73506A0
    GO
    Isoform 2 (identifier: Q99755-2) [UniParc]FASTAAdd to basket
    Also known as: PIP5KIalpha31 Publication

    The sequence of this isoform differs from the canonical sequence as follows:
         30-52: ASGIKRPMASEVLEARQDSYISL → SGIKRPMASE
         455-504: LKPSPSKKFRSGSSFSRRAGSSGNSCITYQPSVSGEHKAQVTTKAEVEPG → C

    Show »
    Length:500
    Mass (Da):56,053
    Checksum:i684F0C9C2DBE9EC4
    GO
    Isoform 3 (identifier: Q99755-3) [UniParc]FASTAAdd to basket
    Also known as: PIP5KIalpha11 Publication

    The sequence of this isoform differs from the canonical sequence as follows:
         30-52: ASGIKRPMASEVLEARQDSYISL → SGIKRPMASE

    Show »
    Length:549
    Mass (Da):61,187
    Checksum:i7CD48BFE175564A0
    GO
    Isoform 4 (identifier: Q99755-4) [UniParc]FASTAAdd to basket

    The sequence of this isoform differs from the canonical sequence as follows:
         41-52: Missing.
         382-410: HMGGIPARNSKGERLLLYIGIIDILQSYR → Q

    Show »
    Length:522
    Mass (Da):58,119
    Checksum:i693CE47DBFC72B5F
    GO

    <p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

    There are 5 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
    EntryEntry nameProtein names
    		Gene namesLengthAnnotation
    A6PW57A6PW57_HUMAN
    Phosphatidylinositol 4-phosphate 5-...
    PIP5K1A
    		550Annotation score:

    Annotation score:2 out of 5

    <p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
    E9PSF8E9PSF8_HUMAN
    Phosphatidylinositol 4-phosphate 5-...
    PIP5K1A
    		39Annotation score:

    Annotation score:1 out of 5

    <p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
    A6PW58A6PW58_HUMAN
    Phosphatidylinositol 4-phosphate 5-...
    PIP5K1A
    		86Annotation score:

    Annotation score:1 out of 5

    <p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
    A2A5X0A2A5X0_HUMAN
    Phosphatidylinositol 4-phosphate 5-...
    PIP5K1A
    		101Annotation score:

    Annotation score:1 out of 5

    <p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
    A6PW56A6PW56_HUMAN
    Phosphatidylinositol 4-phosphate 5-...
    PIP5K1A
    		41Annotation score:

    Annotation score:1 out of 5

    <p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

    Experimental Info

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti257K → E in BAG58542 (PubMed:14702039).Curated1

    Alternative sequence

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_01600730 – 52ASGIK…SYISL → SGIKRPMASE in isoform 2 and isoform 3. 3 PublicationsAdd BLAST23
    Alternative sequenceiVSP_04191241 – 52Missing in isoform 4. 1 PublicationAdd BLAST12
    Alternative sequenceiVSP_041913382 – 410HMGGI…LQSYR → Q in isoform 4. 1 PublicationAdd BLAST29
    Alternative sequenceiVSP_016008455 – 504LKPSP…EVEPG → C in isoform 2. 2 PublicationsAdd BLAST50

    Sequence databases

    Select the link destinations:

    EMBL nucleotide sequence database

    More...    EMBLi

    GenBank nucleotide sequence database

    More...    GenBanki

    DNA Data Bank of Japan; a nucleotide sequence database

    More...    DDBJi
    Links Updated
    		U78575 mRNA Translation: AAC50910.1
    U78576 mRNA Translation: AAC50911.1
    U78577 mRNA Translation: AAC50912.1
    AK291015 mRNA Translation: BAF83704.1
    AK295691 mRNA Translation: BAG58542.1
    AL592424 Genomic DNA No translation available.
    CH471121 Genomic DNA Translation: EAW53461.1
    BC007833 mRNA Translation: AAH07833.1

    The Consensus CDS (CCDS) project

    More...    CCDSi    		CCDS44219.1 [Q99755-1]
    CCDS44220.1 [Q99755-4]
    CCDS44221.1 [Q99755-2]
    CCDS990.1 [Q99755-3]

    NCBI Reference Sequences

    More...    RefSeqi    		NP_001129108.1, NM_001135636.1 [Q99755-4]
    NP_001129109.1, NM_001135637.1 [Q99755-2]
    NP_001129110.1, NM_001135638.1 [Q99755-1]
    NP_001317618.1, NM_001330689.1
    NP_003548.1, NM_003557.2 [Q99755-3]

    Genome annotation databases

    Ensembl eukaryotic genome annotation project

    More...    Ensembli    		ENST00000349792; ENSP00000271663; ENSG00000143398 [Q99755-3]
    ENST00000368888; ENSP00000357883; ENSG00000143398 [Q99755-1]
    ENST00000368890; ENSP00000357885; ENSG00000143398 [Q99755-2]
    ENST00000441902; ENSP00000415648; ENSG00000143398 [Q99755-4]

    Database of genes from NCBI RefSeq genomes

    More...    GeneIDi    		8394

    KEGG: Kyoto Encyclopedia of Genes and Genomes

    More...    KEGGi    		hsa:8394

    UCSC genome browser

    More...    UCSCi    		uc001exi.4, human [Q99755-1]

    Keywords - Coding sequence diversityi

    Alternative splicing

    <p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

    <p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBLi
    GenBanki
    DDBJi
    Links Updated
    		U78575 mRNA Translation: AAC50910.1
    U78576 mRNA Translation: AAC50911.1
    U78577 mRNA Translation: AAC50912.1
    AK291015 mRNA Translation: BAF83704.1
    AK295691 mRNA Translation: BAG58542.1
    AL592424 Genomic DNA No translation available.
    CH471121 Genomic DNA Translation: EAW53461.1
    BC007833 mRNA Translation: AAH07833.1
    CCDSiCCDS44219.1 [Q99755-1]
    CCDS44220.1 [Q99755-4]
    CCDS44221.1 [Q99755-2]
    CCDS990.1 [Q99755-3]
    RefSeqiNP_001129108.1, NM_001135636.1 [Q99755-4]
    NP_001129109.1, NM_001135637.1 [Q99755-2]
    NP_001129110.1, NM_001135638.1 [Q99755-1]
    NP_001317618.1, NM_001330689.1
    NP_003548.1, NM_003557.2 [Q99755-3]

    3D structure databases

    SMRiQ99755
    ModBaseiSearch...

    Protein-protein interaction databases

    BioGRIDi113983, 77 interactors
    DIPiDIP-60649N
    IntActiQ99755, 38 interactors
    STRINGi9606.ENSP00000357883

    Chemistry databases

    BindingDBiQ99755
    ChEMBLiCHEMBL5969
    DrugCentraliQ99755
    SwissLipidsiSLP:000000553 [Q99755-3]
    SLP:000000554

    PTM databases

    iPTMnetiQ99755
    PhosphoSitePlusiQ99755
    SwissPalmiQ99755

    Genetic variation databases

    BioMutaiPIP5K1A
    DMDMi74752158

    Proteomic databases

    EPDiQ99755
    jPOSTiQ99755
    MassIVEiQ99755
    MaxQBiQ99755
    PaxDbiQ99755
    PeptideAtlasiQ99755
    PRIDEiQ99755
    ProteomicsDBi78458 [Q99755-1]
    78459 [Q99755-2]
    78460 [Q99755-3]
    78461 [Q99755-4]

    Protocols and materials databases

    Antibodypedia a portal for validated antibodies

    More...    Antibodypediai    		34058, 188 antibodies

    The DNASU plasmid repository

    More...    DNASUi    		8394

    Genome annotation databases

    EnsembliENST00000349792; ENSP00000271663; ENSG00000143398 [Q99755-3]
    ENST00000368888; ENSP00000357883; ENSG00000143398 [Q99755-1]
    ENST00000368890; ENSP00000357885; ENSG00000143398 [Q99755-2]
    ENST00000441902; ENSP00000415648; ENSG00000143398 [Q99755-4]
    GeneIDi8394
    KEGGihsa:8394
    UCSCiuc001exi.4, human [Q99755-1]

    Organism-specific databases

    Comparative Toxicogenomics Database

    More...    CTDi    		8394
    DisGeNETi8394

    GeneCards: human genes, protein and diseases

    More...    GeneCardsi    		PIP5K1A
    HGNCiHGNC:8994, PIP5K1A
    HPAiENSG00000143398, Low tissue specificity
    MIMi603275, gene
    neXtProtiNX_Q99755
    OpenTargetsiENSG00000143398
    PharmGKBiPA33327
    VEuPathDBiHostDB:ENSG00000143398.19

    GenAtlas: human gene database

    More...    GenAtlasi    		Search...

    Phylogenomic databases

    eggNOGiKOG0229, Eukaryota
    GeneTreeiENSGT00940000154703
    HOGENOMiCLU_004312_5_1_1
    InParanoidiQ99755
    OMAiIGHRRID
    OrthoDBi1562683at2759
    PhylomeDBiQ99755
    TreeFamiTF319618

    Enzyme and pathway databases

    BioCyciMetaCyc:HS07047-MONOMER
    BRENDAi2.7.1.68, 2681
    PathwayCommonsiQ99755
    ReactomeiR-HSA-1660499, Synthesis of PIPs at the plasma membrane
    R-HSA-6811558, PI5P, PP2A and IER3 Regulate PI3K/AKT Signaling
    SignaLinkiQ99755
    SIGNORiQ99755

    Miscellaneous databases

    BioGRID ORCS database of CRISPR phenotype screens

    More...    BioGRID-ORCSi    		8394, 103 hits in 1003 CRISPR screens

    ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

    More...    ChiTaRSi    		PIP5K1A, human

    The Gene Wiki collection of pages on human genes and proteins

    More...    GeneWikii    		PIP5K1A

    Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

    More...    GenomeRNAii    		8394
    PharosiQ99755, Tbio

    Protein Ontology

    More...    PROi    		PR:Q99755
    RNActiQ99755, protein

    The Stanford Online Universal Resource for Clones and ESTs

    More...    SOURCEi    		Search...

    Gene expression databases

    BgeeiENSG00000143398, Expressed in esophagogastric junction muscularis propria and 236 other tissues
    ExpressionAtlasiQ99755, baseline and differential
    GenevisibleiQ99755, HS

    Family and domain databases

    Gene3Di3.30.800.10, 1 hit
    3.30.810.10, 2 hits
    InterProiView protein in InterPro
    IPR023610, PInositol-4-P-5-kinase
    IPR027483, PInositol-4-P-5-kinase_C
    IPR002498, PInositol-4-P-5-kinase_core
    IPR027484, PInositol-4-P-5-kinase_N
    PANTHERiPTHR23086, PTHR23086, 1 hit
    PfamiView protein in Pfam
    PF01504, PIP5K, 1 hit
    SMARTiView protein in SMART
    SM00330, PIPKc, 1 hit
    PROSITEiView protein in PROSITE
    PS51455, PIPK, 1 hit

    MobiDB: a database of protein disorder and mobility annotations

    More...    MobiDBi    		Search...

    <p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

    <p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiPI51A_HUMAN
    <p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q99755
    Secondary accession number(s): A8K4Q0
    , B4DIN0, Q99754, Q99756
    <p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 25, 2005
    Last sequence update: May 1, 1997
    Last modified: June 2, 2021
    This is version 178 of the entry and version 1 of the sequence. See complete history.
    <p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    <p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

    Keywords - Technical termi

    Reference proteome

    Documents

    1. Human chromosome 1
      Human chromosome 1: entries, gene names and cross-references to MIM
    2. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    UniProt is an ELIXIR core data resource
    Main funding by: National Institutes of Health

    We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

    Do not show this banner again