Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - Q99755 (PI51A_HUMAN)

Entry version 173 (17 Jun 2020)
Sequence version 1 (01 May 1997)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Phosphatidylinositol 4-phosphate 5-kinase type-1 alpha

Gene

PIP5K1A

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Catalyzes the phosphorylation of phosphatidylinositol 4-phosphate (PtdIns4P) to form phosphatidylinositol 4,5-bisphosphate (PtdIns(4,5)P2). PtdIns(4,5)P2 is involved in a variety of cellular processes and is the substrate to form phosphatidylinositol 3,4,5-trisphosphate (PtdIns(3,4,5)P3), another second messenger. The majority of PtdIns(4,5)P2 is thought to occur via type I phosphatidylinositol 4-phosphate 5-kinases given the abundance of PtdIns4P. Participates in a variety of cellular processes such as actin cytoskeleton organization, cell adhesion, migration and phagocytosis. Required for membrane ruffling formation, actin organization and focal adhesion formation during directional cell migration by controlling integrin-induced translocation of RAC1 to the plasma membrane. Together with PIP5K1C is required for phagocytosis, but they regulate different types of actin remodeling at sequential steps. Promotes particle ingestion by activating WAS that induces Arp2/3 dependent actin polymerization at the nascent phagocytic cup. Together with PIP5K1B is required after stimulation of G-protein coupled receptors for stable platelet adhesion. Plays a role during calcium-induced keratinocyte differentiation. Recruited to the plasma membrane by the E-cadherin/beta-catenin complex where it provides the substrate PtdIns(4,5)P2 for the production of PtdIns(3,4,5)P3, diacylglycerol and inositol 1,4,5-trisphosphate that mobilize internal calcium and drive keratinocyte differentiation. Together with PIP5K1C have a role during embryogenesis. Functions also in the nucleus where acts as an activator of TUT1 adenylyltransferase activity in nuclear speckles, thereby regulating mRNA polyadenylation of a select set of mRNAs (PubMed:18288197, PubMed:19158393, PubMed:20660631). Positively regulates insulin-induced translocation of SLC2A4 to the cell membrane in adipocytes (By similarity).By similarity3 Publications

Caution

There is confusion in the literature with phosphatidylinositol 4-phosphate 5-kinase type I nomenclature due to the fact that frequently mouse PIP5K1B is named Phosphatidylinositol 4-phosphate 5-kinase type I alpha.Curated

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionKinase, Transferase
LigandATP-binding, Nucleotide-binding

Enzyme and pathway databases

BioCyc Collection of Pathway/Genome Databases

More...BioCyci		MetaCyc:HS07047-MONOMER

BRENDA Comprehensive Enzyme Information System

More...BRENDAi		2.7.1.68 2681

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-1660499 Synthesis of PIPs at the plasma membrane
R-HSA-6811558 PI5P, PP2A and IER3 Regulate PI3K/AKT Signaling

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...SignaLinki		Q99755

SIGNOR Signaling Network Open Resource

More...SIGNORi		Q99755

Chemistry databases

SwissLipids knowledge resource for lipid biology

More...SwissLipidsi		SLP:000000553 [Q99755-3]
SLP:000000554

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Phosphatidylinositol 4-phosphate 5-kinase type-1 alpha (EC:2.7.1.68)
Short name:
PIP5K1-alpha
Short name:
PtdIns(4)P-5-kinase 1 alpha
Alternative name(s):
68 kDa type I phosphatidylinositol 4-phosphate 5-kinase alpha
Phosphatidylinositol 4-phosphate 5-kinase type I alpha
Short name:
PIP5KIalpha
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:PIP5K1A
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 1

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...EuPathDBi		HostDB:ENSG00000143398.19

Human Gene Nomenclature Database

More...HGNCi		HGNC:8994 PIP5K1A

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		603275 gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_Q99755

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell membrane, Cell projection, Cytoplasm, Membrane, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology%5Fand%5Fbiotech%5Fsection">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi322D → N: Does not affect targeting of RAC1 to the plasma membrane; when associated with Q-440. 1 Publication1
Mutagenesisi440R → Q: Does not affect targeting of RAC1 to the plasma membrane; when associated with N-322. 1 Publication1

Organism-specific databases

DisGeNET

More...DisGeNETi		8394

Open Targets

More...OpenTargetsi		ENSG00000143398

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA33327

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		Q99755 Tbio

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...ChEMBLi		CHEMBL5969

DrugCentral

More...DrugCentrali		Q99755

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		PIP5K1A

Domain mapping of disease mutations (DMDM)

More...DMDMi		74752158

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001854561 – 562Phosphatidylinositol 4-phosphate 5-kinase type-1 alphaAdd BLAST562

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section describes <strong>covalent linkages</strong> of various types formed <strong>between two proteins (interchain cross-links)</strong> or <strong>between two parts of the same protein (intrachain cross-links)</strong>, except the disulfide bonds that are annotated in the <a href="http://www.uniprot.org/manual/disulfid">'Disulfide bond'</a> subsection.<p><a href='/help/crosslnk' target='_top'>More...</a></p>Cross-linki103Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei486PhosphoserineCombined sources1

Keywords - PTMi

Isopeptide bond, Phosphoprotein, Ubl conjugation

Proteomic databases

Encyclopedia of Proteome Dynamics

More...EPDi		Q99755

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		Q99755

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		Q99755

MaxQB - The MaxQuant DataBase

More...MaxQBi		Q99755

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q99755

PeptideAtlas

More...PeptideAtlasi		Q99755

PRoteomics IDEntifications database

More...PRIDEi		Q99755

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		78458 [Q99755-1]
78459 [Q99755-2]
78460 [Q99755-3]
78461 [Q99755-4]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q99755

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q99755

SwissPalm database of S-palmitoylation events

More...SwissPalmi		Q99755

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Highly expressed in heart, placenta, skeletal muscle, kidney and pancreas. Detected at lower levels in brain, lung and liver.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000143398 Expressed in esophagogastric junction muscularis propria and 223 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		Q99755 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q99755 HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000143398 Low tissue specificity

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with RAC1 (By similarity).

Interacts with TUT1.

Forms a complex with CDH1/E-cadherin, CTNNB1/beta-catenin and CTNND1 at the plasma membrane upon calcium stimulation (PubMed:18288197, PubMed:19158393).

Found in a ternary complex with IRS1 and DGKZ in the absence of insulin stimulation (By similarity).

Interacts with DGKZ (PubMed:15157668).

By similarity3 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

GO - Molecular functioni

Complete GO annotation on QuickGO ...

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		113983, 73 interactors

Database of interacting proteins

More...DIPi		DIP-60649N

Protein interaction database and analysis system

More...IntActi		Q99755, 37 interactors

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000357883

Chemistry databases

BindingDB database of measured binding affinities

More...BindingDBi		Q99755

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		Q99755 protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		Q99755

Database of comparative protein structure models

More...ModBasei		Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini81 – 449PIPKPROSITE-ProRule annotationAdd BLAST369

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG0229 Eukaryota
COG5253 LUCA

Ensembl GeneTree

More...GeneTreei		ENSGT00940000154703

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_004312_5_1_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q99755

KEGG Orthology (KO)

More...KOi		K00889

Identification of Orthologs from Complete Genome Data

More...OMAi		IGHRRID

Database of Orthologous Groups

More...OrthoDBi		1562683at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q99755

TreeFam database of animal gene trees

More...TreeFami		TF319618

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...Gene3Di		3.30.800.10, 1 hit
3.30.810.10, 2 hits

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR023610 PInositol-4-P-5-kinase
IPR027483 PInositol-4-P-5-kinase_C
IPR002498 PInositol-4-P-5-kinase_core
IPR027484 PInositol-4-P-5-kinase_N

The PANTHER Classification System

More...PANTHERi		PTHR23086 PTHR23086, 1 hit

Pfam protein domain database

More...Pfami		View protein in Pfam
PF01504 PIP5K, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00330 PIPKc, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS51455 PIPK, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 5 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q99755-1) [UniParc]FASTAAdd to basket
Also known as: PIP5KIalpha2

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MASASSGPSS SVGFSSFDPA VPSCTLSSAA SGIKRPMASE VLEARQDSYI 
        60         70         80         90        100
SLVPYASGMP IKKIGHRSVD SSGETTYKKT TSSALKGAIQ LGITHTVGSL 
       110        120        130        140        150
STKPERDVLM QDFYVVESIF FPSEGSNLTP AHHYNDFRFK TYAPVAFRYF 
       160        170        180        190        200
RELFGIRPDD YLYSLCSEPL IELCSSGASG SLFYVSSDDE FIIKTVQHKE 
       210        220        230        240        250
AEFLQKLLPG YYMNLNQNPR TLLPKFYGLY CVQAGGKNIR IVVMNNLLPR 
       260        270        280        290        300
SVKMHIKYDL KGSTYKRRAS QKEREKPLPT FKDLDFLQDI PDGLFLDADM 
       310        320        330        340        350
YNALCKTLQR DCLVLQSFKI MDYSLLMSIH NIDHAQREPL SSETQYSVDT 
       360        370        380        390        400
RRPAPQKALY STAMESIQGE ARRGGTMETD DHMGGIPARN SKGERLLLYI 
       410        420        430        440        450
GIIDILQSYR FVKKLEHSWK ALVHDGDTVS VHRPGFYAER FQRFMCNTVF 
       460        470        480        490        500
KKIPLKPSPS KKFRSGSSFS RRAGSSGNSC ITYQPSVSGE HKAQVTTKAE 
       510        520        530        540        550
VEPGVHLGRP DVLPQTPPLE EISEGSPIPD PSFSPLVGET LQMLTTSTTL 
       560 
EKLEVAESEF TH
Length:562
Mass (Da):62,633
Last modified:May 1, 1997 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iA8F7988EB73506A0
GO
Isoform 2 (identifier: Q99755-2) [UniParc]FASTAAdd to basket
Also known as: PIP5KIalpha3

The sequence of this isoform differs from the canonical sequence as follows:
     30-52: ASGIKRPMASEVLEARQDSYISL → SGIKRPMASE
     455-504: LKPSPSKKFRSGSSFSRRAGSSGNSCITYQPSVSGEHKAQVTTKAEVEPG → C

Show »
Length:500
Mass (Da):56,053
Checksum:i684F0C9C2DBE9EC4
GO
Isoform 3 (identifier: Q99755-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     30-52: ASGIKRPMASEVLEARQDSYISL → SGIKRPMASE

Show »
Length:549
Mass (Da):61,187
Checksum:i7CD48BFE175564A0
GO
Isoform 4 (identifier: Q99755-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     41-52: Missing.
     382-410: HMGGIPARNSKGERLLLYIGIIDILQSYR → Q

Show »
Length:522
Mass (Da):58,119
Checksum:i693CE47DBFC72B5F
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 5 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A6PW57A6PW57_HUMAN
Phosphatidylinositol 4-phosphate 5-...
PIP5K1A
550Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9PSF8E9PSF8_HUMAN
Phosphatidylinositol 4-phosphate 5-...
PIP5K1A
39Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A6PW58A6PW58_HUMAN
Phosphatidylinositol 4-phosphate 5-...
PIP5K1A
86Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A2A5X0A2A5X0_HUMAN
Phosphatidylinositol 4-phosphate 5-...
PIP5K1A
101Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A6PW56A6PW56_HUMAN
Phosphatidylinositol 4-phosphate 5-...
PIP5K1A
41Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti257K → E in BAG58542 (PubMed:14702039).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_01600730 – 52ASGIK…SYISL → SGIKRPMASE in isoform 2 and isoform 3. 3 PublicationsAdd BLAST23
Alternative sequenceiVSP_04191241 – 52Missing in isoform 4. 1 PublicationAdd BLAST12
Alternative sequenceiVSP_041913382 – 410HMGGI…LQSYR → Q in isoform 4. 1 PublicationAdd BLAST29
Alternative sequenceiVSP_016008455 – 504LKPSP…EVEPG → C in isoform 2. 2 PublicationsAdd BLAST50

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
U78575 mRNA Translation: AAC50910.1
U78576 mRNA Translation: AAC50911.1
U78577 mRNA Translation: AAC50912.1
AK291015 mRNA Translation: BAF83704.1
AK295691 mRNA Translation: BAG58542.1
AL592424 Genomic DNA No translation available.
CH471121 Genomic DNA Translation: EAW53461.1
BC007833 mRNA Translation: AAH07833.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS44219.1 [Q99755-1]
CCDS44220.1 [Q99755-4]
CCDS44221.1 [Q99755-2]
CCDS990.1 [Q99755-3]

NCBI Reference Sequences

More...RefSeqi		NP_001129108.1, NM_001135636.1 [Q99755-4]
NP_001129109.1, NM_001135637.1 [Q99755-2]
NP_001129110.1, NM_001135638.1 [Q99755-1]
NP_001317618.1, NM_001330689.1
NP_003548.1, NM_003557.2 [Q99755-3]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000349792; ENSP00000271663; ENSG00000143398 [Q99755-3]
ENST00000368888; ENSP00000357883; ENSG00000143398 [Q99755-1]
ENST00000368890; ENSP00000357885; ENSG00000143398 [Q99755-2]
ENST00000441902; ENSP00000415648; ENSG00000143398 [Q99755-4]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		8394

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:8394

UCSC genome browser

More...UCSCi		uc001exi.4 human [Q99755-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U78575 mRNA Translation: AAC50910.1
U78576 mRNA Translation: AAC50911.1
U78577 mRNA Translation: AAC50912.1
AK291015 mRNA Translation: BAF83704.1
AK295691 mRNA Translation: BAG58542.1
AL592424 Genomic DNA No translation available.
CH471121 Genomic DNA Translation: EAW53461.1
BC007833 mRNA Translation: AAH07833.1
CCDSiCCDS44219.1 [Q99755-1]
CCDS44220.1 [Q99755-4]
CCDS44221.1 [Q99755-2]
CCDS990.1 [Q99755-3]
RefSeqiNP_001129108.1, NM_001135636.1 [Q99755-4]
NP_001129109.1, NM_001135637.1 [Q99755-2]
NP_001129110.1, NM_001135638.1 [Q99755-1]
NP_001317618.1, NM_001330689.1
NP_003548.1, NM_003557.2 [Q99755-3]

3D structure databases

SMRiQ99755
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi113983, 73 interactors
DIPiDIP-60649N
IntActiQ99755, 37 interactors
STRINGi9606.ENSP00000357883

Chemistry databases

BindingDBiQ99755
ChEMBLiCHEMBL5969
DrugCentraliQ99755
SwissLipidsiSLP:000000553 [Q99755-3]
SLP:000000554

PTM databases

iPTMnetiQ99755
PhosphoSitePlusiQ99755
SwissPalmiQ99755

Polymorphism and mutation databases

BioMutaiPIP5K1A
DMDMi74752158

Proteomic databases

EPDiQ99755
jPOSTiQ99755
MassIVEiQ99755
MaxQBiQ99755
PaxDbiQ99755
PeptideAtlasiQ99755
PRIDEiQ99755
ProteomicsDBi78458 [Q99755-1]
78459 [Q99755-2]
78460 [Q99755-3]
78461 [Q99755-4]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		34058 175 antibodies

The DNASU plasmid repository

More...DNASUi		8394

Genome annotation databases

EnsembliENST00000349792; ENSP00000271663; ENSG00000143398 [Q99755-3]
ENST00000368888; ENSP00000357883; ENSG00000143398 [Q99755-1]
ENST00000368890; ENSP00000357885; ENSG00000143398 [Q99755-2]
ENST00000441902; ENSP00000415648; ENSG00000143398 [Q99755-4]
GeneIDi8394
KEGGihsa:8394
UCSCiuc001exi.4 human [Q99755-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		8394
DisGeNETi8394
EuPathDBiHostDB:ENSG00000143398.19

GeneCards: human genes, protein and diseases

More...GeneCardsi		PIP5K1A
HGNCiHGNC:8994 PIP5K1A
HPAiENSG00000143398 Low tissue specificity
MIMi603275 gene
neXtProtiNX_Q99755
OpenTargetsiENSG00000143398
PharmGKBiPA33327

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG0229 Eukaryota
COG5253 LUCA
GeneTreeiENSGT00940000154703
HOGENOMiCLU_004312_5_1_1
InParanoidiQ99755
KOiK00889
OMAiIGHRRID
OrthoDBi1562683at2759
PhylomeDBiQ99755
TreeFamiTF319618

Enzyme and pathway databases

BioCyciMetaCyc:HS07047-MONOMER
BRENDAi2.7.1.68 2681
ReactomeiR-HSA-1660499 Synthesis of PIPs at the plasma membrane
R-HSA-6811558 PI5P, PP2A and IER3 Regulate PI3K/AKT Signaling
SignaLinkiQ99755
SIGNORiQ99755

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		8394 88 hits in 790 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		PIP5K1A human

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		PIP5K1A

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		8394
PharosiQ99755 Tbio

Protein Ontology

More...PROi		PR:Q99755
RNActiQ99755 protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000143398 Expressed in esophagogastric junction muscularis propria and 223 other tissues
ExpressionAtlasiQ99755 baseline and differential
GenevisibleiQ99755 HS

Family and domain databases

Gene3Di3.30.800.10, 1 hit
3.30.810.10, 2 hits
InterProiView protein in InterPro
IPR023610 PInositol-4-P-5-kinase
IPR027483 PInositol-4-P-5-kinase_C
IPR002498 PInositol-4-P-5-kinase_core
IPR027484 PInositol-4-P-5-kinase_N
PANTHERiPTHR23086 PTHR23086, 1 hit
PfamiView protein in Pfam
PF01504 PIP5K, 1 hit
SMARTiView protein in SMART
SM00330 PIPKc, 1 hit
PROSITEiView protein in PROSITE
PS51455 PIPK, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiPI51A_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q99755
Secondary accession number(s): A8K4Q0
, B4DIN0, Q99754, Q99756
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 25, 2005
Last sequence update: May 1, 1997
Last modified: June 17, 2020
This is version 173 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again