Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

RANBP2-like and GRIP domain-containing protein 5/6

Gene

RGPD5

more
Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Miscellaneous

One of the 8 copies of RANBP2 clustered close to the chromosome 2 centromere.

GO - Molecular functioni

  • Ran GTPase binding Source: GO_Central

GO - Biological processi

Names & Taxonomyi

Protein namesi
Recommended name:
RANBP2-like and GRIP domain-containing protein 5/6
Alternative name(s):
Ran-binding protein 2-like 1/2
Short name:
RanBP2-like 1/2
Short name:
RanBP2L1
Short name:
RanBP2L2
Sperm membrane protein BS-63
Gene namesi
Name:RGPD5
Synonyms:RANBP2L1, RGP5, RGP7, RGPD7
AND
Name:RGPD6
Synonyms:RANBP2L2, RGP6
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 2

Organism-specific databases

EuPathDBiHostDB:ENSG00000015568.12
HostDB:ENSG00000183054.11
HGNCiHGNC:32418 RGPD5
HGNC:32419 RGPD6
MIMi612708 gene
612709 gene
612710 gene
neXtProtiNX_Q99666

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000015568
PharmGKBiPA142671074

Polymorphism and mutation databases

BioMutaiRGPD5
DMDMi229463026

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002049151 – 1765RANBP2-like and GRIP domain-containing protein 5/6Add BLAST1765

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei19PhosphothreonineCombined sources1
Modified residuei21PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ99666
PaxDbiQ99666
PeptideAtlasiQ99666
PRIDEiQ99666
ProteomicsDBi78386
78387 [Q99666-2]

PTM databases

iPTMnetiQ99666
PhosphoSitePlusiQ99666

Expressioni

Tissue specificityi

Expressed in testis.1 Publication

Gene expression databases

BgeeiENSG00000015568 Expressed in 201 organ(s), highest expression level in testis
CleanExiHS_RGPD5
HS_RGPD8
ExpressionAtlasiQ99666 baseline and differential
GenevisibleiQ99666 HS

Organism-specific databases

HPAiHPA045704
HPA049497
HPA051675
HPA067564

Interactioni

GO - Molecular functioni

Protein-protein interaction databases

BioGridi123954, 51 interactors
609938, 5 interactors
IntActiQ99666, 8 interactors
STRINGi9606.ENSP00000330842

Structurei

3D structure databases

ProteinModelPortaliQ99666
SMRiQ99666
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Repeati26 – 59TPR 1Add BLAST34
Repeati60 – 93TPR 2Add BLAST34
Repeati648 – 681TPR 3Add BLAST34
Domaini1036 – 1172RanBD1 1PROSITE-ProRule annotationAdd BLAST137
Domaini1333 – 1469RanBD1 2PROSITE-ProRule annotationAdd BLAST137
Domaini1702 – 1752GRIPPROSITE-ProRule annotationAdd BLAST51

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi1261 – 1266Poly-Ser6

Keywords - Domaini

Repeat, TPR repeat

Phylogenomic databases

eggNOGiKOG0864 Eukaryota
COG5171 LUCA
GeneTreeiENSGT00760000119119
HOGENOMiHOG000089994
HOVERGENiHBG057535
InParanoidiQ99666
KOiK12172
OrthoDBiEOG0937017V
PhylomeDBiQ99666
TreeFamiTF314797

Family and domain databases

Gene3Di1.25.40.10, 1 hit
2.30.29.30, 2 hits
InterProiView protein in InterPro
IPR032023 GCC2_Rab_bind
IPR000237 GRIP_dom
IPR011993 PH-like_dom_sf
IPR000156 Ran_bind_dom
IPR013026 TPR-contain_dom
IPR011990 TPR-like_helical_dom_sf
IPR019734 TPR_repeat
PfamiView protein in Pfam
PF01465 GRIP, 1 hit
PF16704 Rab_bind, 1 hit
PF00638 Ran_BP1, 2 hits
SMARTiView protein in SMART
SM00755 Grip, 1 hit
SM00160 RanBD, 2 hits
SM00028 TPR, 1 hit
SUPFAMiSSF48452 SSF48452, 1 hit
PROSITEiView protein in PROSITE
PS50913 GRIP, 1 hit
PS50196 RANBD1, 2 hits
PS50005 TPR, 1 hit
PS50293 TPR_REGION, 1 hit

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: Q99666-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MRRSKADVER YVASVLGLTP SPRQKSMKGF YFAKLYYEAK EYDLAKKYIC
60 70 80 90 100
TYINVQERDP KAHRFLGLLY ELEENTEKAV ECYRRSVELN PTQKDLVLKI
110 120 130 140 150
AELLCKNDVT DGRAKYWVER AAKLFPGSPA IYKLKEQLLD CEGEDGWNKL
160 170 180 190 200
FDLIQSELYV RPDDVHVNIR LVELYRSTKR LKDAVAHCHE AERNIALRSS
210 220 230 240 250
LEWNSCVVQT LKEYLESLQC LESDKSDWQA TNTDLLLAYA NLMLLTLSTR
260 270 280 290 300
DVQENRELLE SFDSALQSAK SSLGGNDELS ATFLEMKGHF YMYAGSLLLK
310 320 330 340 350
MGQHGNNVQW RALSELAALC YLIAFQVPRP KIKLREGKAG QNLLEMMACD
360 370 380 390 400
RLSQSGHMLL SLSRGKQDFL KEVVETFANK IGQSALYDAL FSSQSPKDTS
410 420 430 440 450
FLGSDDIGKI DVQEPELEDL ARYDVGAIRA HNGSLQHLTW LGLQWNSLPA
460 470 480 490 500
LPGIRKWLKQ LFHRLPHETS RLETNAPESI CILDLEVFLL GVVYTSHLQL
510 520 530 540 550
KEKCNSHHSS YQPLCLPFPV CKQLCTERQK SWWDAVCTLI HRKAVPGNLA
560 570 580 590 600
KLRLLVQHEI NTLRAQEKHG LQPALLVHWA KYLQKTGSGL NSFYGQLEYI
610 620 630 640 650
GRSVHYWKKV LPLLKIIKKN SIPEPIDPLF KHFHSVDIQA SEIVEYEEDA
660 670 680 690 700
HITFAMLDAV NGNIEDAVTA FESIKSVVSY WNLALIFHRK AEDIENDALS
710 720 730 740 750
PEEQEECRNY LTKTRDYLIK IIDDGDSNLS VVKKLPVPLE SVKQMLNSVM
760 770 780 790 800
QELEDYSEGG PLYKNGSLRN ADSEIKHSTP SPTKYSLSPS KSYKYSPETP
810 820 830 840 850
PRWTEDRNSL LNMICQQVEA IKKEMQELKL NSSKSASRHR WPTENYGPDS
860 870 880 890 900
VPDGYQGSQT FHGAPLTVAT TGPSVYYSQS PAYNSQYLLR PAANVTPTKG
910 920 930 940 950
SSNTEFKSTK EGFSIPVSAD GFKFGISEPG NQEKKREKPL ENDTGFQAQD
960 970 980 990 1000
ISGRKKGRGV IFGQTSSTFT FADVAKSTSG EGFQFGKKDL NFKGFSGAGE
1010 1020 1030 1040 1050
KLFSSRYGKM ANKANTSGDF EKDDDAYKTE DSDDIHFEPV VQMPEKVELV
1060 1070 1080 1090 1100
TGEEGEKVLY SQGVKLFRFD AEVRQWKERG LGNLKILKNE VNGKLRMLMR
1110 1120 1130 1140 1150
REQVLKVCAN HWITTTMNLK PLSGSDRAWM WSASDFSDGD AKLERLAAKF
1160 1170 1180 1190 1200
KTPELAEEFK QKFEECQRLL LDIPLQTPHK LVDTGRAAKL IQRAEEMKSG
1210 1220 1230 1240 1250
LKDFKTFLTN DQTKVTEEEN KGSGTGAAGA SDTTIKPNAE NTGPTLEWDN
1260 1270 1280 1290 1300
YDLREDALDD SVSSSSVHAS PLASSPVRKN LFRFDESTTG SNFSFKSALS
1310 1320 1330 1340 1350
LSKSPAKLNQ SGTSVGTDEE SVVTQEEERD GQYFEPVVPL PDLVEVSSGE
1360 1370 1380 1390 1400
ENEQVVFSHR AEIYRYDKDV GQWKERGIGD IKILQNYDNK QVRIVMRRDQ
1410 1420 1430 1440 1450
VLKLCANHRI TPDMSLQNMK GTERVWVWTA CDFADGERKV EHLAVRFKLQ
1460 1470 1480 1490 1500
DVADSFKKIF DEAKTAQEKD SLITPHVSRS STPRESPCGK IAVAILEETT
1510 1520 1530 1540 1550
RERTDVIQGD DVADAASEVE VSSTSETTTK AVVSPPKFVF VSESVKRIFS
1560 1570 1580 1590 1600
SEKSKPFVFG NSSATGSLFG FSFNAPLKSN NSETSSVAQS GSESKVEPKK
1610 1620 1630 1640 1650
CELSKNSDIE QSSDSKVKNL SASFPTEESS INYTFKTPEK EPPLWHAEFT
1660 1670 1680 1690 1700
KEELVQKLRS TTKSADHLNG LLREIEATNA VLMEQIKLLK SEIRRLERNQ
1710 1720 1730 1740 1750
EREKSAANLE YLKNVLLQFI FLKPGSERER LLPVINTMLQ LSPEEKGKLA
1760
AVAQDEEENA SRSSG
Length:1,765
Mass (Da):198,924
Last modified:May 5, 2009 - v3
Checksum:iDC699DC82C67749D
GO
Isoform 2 (identifier: Q99666-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     868-904: VATTGPSVYYSQSPAYNSQYLLRPAANVTPTKGSSNT → EAAHRHFTIEKHGDSKWIIYRFTKQLCGTERARAKIS
     905-1765: Missing.

Show »
Length:904
Mass (Da):103,334
Checksum:i32030C739F6E72EE
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti174L → V in AAB41848 (PubMed:10101573).Curated1
Sequence conflicti204N → H in AAB41848 (PubMed:10101573).Curated1
Sequence conflicti214Y → H in AAB41848 (PubMed:10101573).Curated1
Sequence conflicti229Q → R in AAB41848 (PubMed:10101573).Curated1
Sequence conflicti257E → G in AAB41848 (PubMed:10101573).Curated1
Sequence conflicti270K → E in AAB41848 (PubMed:10101573).Curated1
Sequence conflicti451L → S in AAB41848 (PubMed:10101573).Curated1
Sequence conflicti736P → S in AAB41848 (PubMed:10101573).Curated1
Sequence conflicti784K → R in AAB41848 (PubMed:10101573).Curated1
Sequence conflicti893A → G in AAB41848 (PubMed:10101573).Curated1
Sequence conflicti905E → D in AAB41848 (PubMed:10101573).Curated1
Sequence conflicti946F → L in AAB41848 (PubMed:10101573).Curated1
Sequence conflicti1074R → S in AAB41848 (PubMed:10101573).Curated1
Sequence conflicti1135D → H in AAB41848 (PubMed:10101573).Curated1
Sequence conflicti1612S → P in AAB41848 (PubMed:10101573).Curated1
Sequence conflicti1682L → P in AAB41848 (PubMed:10101573).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_038968868 – 904VATTG…GSSNT → EAAHRHFTIEKHGDSKWIIY RFTKQLCGTERARAKIS in isoform 2. 1 PublicationAdd BLAST37
Alternative sequenceiVSP_038969905 – 1765Missing in isoform 2. 1 PublicationAdd BLAST861

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U64675 mRNA Translation: AAB41848.2
AL136868 mRNA Translation: CAB66802.1
AC013271 Genomic DNA Translation: AAY14902.1
AC123886 Genomic DNA Translation: AAY14839.1
AC108938 Genomic DNA Translation: AAY24132.1
AC109815 Genomic DNA No translation available.
AB209082 mRNA Translation: BAD92319.1
CCDSiCCDS2082.1 [Q99666-1]
CCDS2083.1 [Q99666-2]
CCDS42729.1 [Q99666-2]
CCDS46388.1 [Q99666-1]
RefSeqiNP_001032955.1, NM_001037866.1 [Q99666-2]
NP_001116835.1, NM_001123363.3 [Q99666-1]
NP_005045.2, NM_005054.2 [Q99666-1]
NP_115636.1, NM_032260.2 [Q99666-2]
UniGeneiHs.469630
Hs.535589
Hs.645445

Genome annotation databases

EnsembliENST00000016946; ENSP00000016946; ENSG00000015568 [Q99666-1]
ENST00000272454; ENSP00000272454; ENSG00000015568 [Q99666-2]
ENST00000329516; ENSP00000330842; ENSG00000183054 [Q99666-1]
ENST00000330331; ENSP00000330023; ENSG00000183054 [Q99666-2]
ENST00000393283; ENSP00000376962; ENSG00000015568 [Q99666-2]
GeneIDi729540
84220
KEGGihsa:729540
hsa:84220
UCSCiuc002tfc.3 human [Q99666-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U64675 mRNA Translation: AAB41848.2
AL136868 mRNA Translation: CAB66802.1
AC013271 Genomic DNA Translation: AAY14902.1
AC123886 Genomic DNA Translation: AAY14839.1
AC108938 Genomic DNA Translation: AAY24132.1
AC109815 Genomic DNA No translation available.
AB209082 mRNA Translation: BAD92319.1
CCDSiCCDS2082.1 [Q99666-1]
CCDS2083.1 [Q99666-2]
CCDS42729.1 [Q99666-2]
CCDS46388.1 [Q99666-1]
RefSeqiNP_001032955.1, NM_001037866.1 [Q99666-2]
NP_001116835.1, NM_001123363.3 [Q99666-1]
NP_005045.2, NM_005054.2 [Q99666-1]
NP_115636.1, NM_032260.2 [Q99666-2]
UniGeneiHs.469630
Hs.535589
Hs.645445

3D structure databases

ProteinModelPortaliQ99666
SMRiQ99666
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi123954, 51 interactors
609938, 5 interactors
IntActiQ99666, 8 interactors
STRINGi9606.ENSP00000330842

PTM databases

iPTMnetiQ99666
PhosphoSitePlusiQ99666

Polymorphism and mutation databases

BioMutaiRGPD5
DMDMi229463026

Proteomic databases

EPDiQ99666
PaxDbiQ99666
PeptideAtlasiQ99666
PRIDEiQ99666
ProteomicsDBi78386
78387 [Q99666-2]

Protocols and materials databases

DNASUi729540
84220
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000016946; ENSP00000016946; ENSG00000015568 [Q99666-1]
ENST00000272454; ENSP00000272454; ENSG00000015568 [Q99666-2]
ENST00000329516; ENSP00000330842; ENSG00000183054 [Q99666-1]
ENST00000330331; ENSP00000330023; ENSG00000183054 [Q99666-2]
ENST00000393283; ENSP00000376962; ENSG00000015568 [Q99666-2]
GeneIDi729540
84220
KEGGihsa:729540
hsa:84220
UCSCiuc002tfc.3 human [Q99666-1]

Organism-specific databases

CTDi729540
84220
EuPathDBiHostDB:ENSG00000015568.12
HostDB:ENSG00000183054.11
GeneCardsiRGPD5
RGPD6
HGNCiHGNC:32418 RGPD5
HGNC:32419 RGPD6
HPAiHPA045704
HPA049497
HPA051675
HPA067564
MIMi612708 gene
612709 gene
612710 gene
neXtProtiNX_Q99666
OpenTargetsiENSG00000015568
PharmGKBiPA142671074
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG0864 Eukaryota
COG5171 LUCA
GeneTreeiENSGT00760000119119
HOGENOMiHOG000089994
HOVERGENiHBG057535
InParanoidiQ99666
KOiK12172
OrthoDBiEOG0937017V
PhylomeDBiQ99666
TreeFamiTF314797

Miscellaneous databases

ChiTaRSiRGPD5 human
RGPD6 human
GeneWikiiRGPD5
PROiPR:Q99666
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000015568 Expressed in 201 organ(s), highest expression level in testis
CleanExiHS_RGPD5
HS_RGPD8
ExpressionAtlasiQ99666 baseline and differential
GenevisibleiQ99666 HS

Family and domain databases

Gene3Di1.25.40.10, 1 hit
2.30.29.30, 2 hits
InterProiView protein in InterPro
IPR032023 GCC2_Rab_bind
IPR000237 GRIP_dom
IPR011993 PH-like_dom_sf
IPR000156 Ran_bind_dom
IPR013026 TPR-contain_dom
IPR011990 TPR-like_helical_dom_sf
IPR019734 TPR_repeat
PfamiView protein in Pfam
PF01465 GRIP, 1 hit
PF16704 Rab_bind, 1 hit
PF00638 Ran_BP1, 2 hits
SMARTiView protein in SMART
SM00755 Grip, 1 hit
SM00160 RanBD, 2 hits
SM00028 TPR, 1 hit
SUPFAMiSSF48452 SSF48452, 1 hit
PROSITEiView protein in PROSITE
PS50913 GRIP, 1 hit
PS50196 RANBD1, 2 hits
PS50005 TPR, 1 hit
PS50293 TPR_REGION, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiRGPD5_HUMAN
AccessioniPrimary (citable) accession number: Q99666
Secondary accession number(s): Q53QN2
, Q53T03, Q59GM7, Q9H0B2
Entry historyiIntegrated into UniProtKB/Swiss-Prot: December 6, 2005
Last sequence update: May 5, 2009
Last modified: November 7, 2018
This is version 150 of the entry and version 3 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again