Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 157 (18 Sep 2019)
Sequence version 3 (05 May 2009)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

RANBP2-like and GRIP domain-containing protein 5/6

Gene

RGPD5

more
Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:4 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Miscellaneous

One of the 8 copies of RANBP2 clustered close to the chromosome 2 centromere.

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • Ran GTPase binding Source: GO_Central

GO - Biological processi

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
RANBP2-like and GRIP domain-containing protein 5/6
Alternative name(s):
Ran-binding protein 2-like 1/2
Short name:
RanBP2-like 1/2
Short name:
RanBP2L1
Short name:
RanBP2L2
Sperm membrane protein BS-63
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:RGPD5
Synonyms:RANBP2L1, RGP5, RGP7, RGPD7
AND
Name:RGPD6
Synonyms:RANBP2L2, RGP6
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 2

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:32418 RGPD5
HGNC:32419 RGPD6

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
612708 gene
612709 gene
612710 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q99666

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Cytoplasm

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

Open Targets

More...
OpenTargetsi
ENSG00000015568

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA142671074

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q99666

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
RGPD5

Domain mapping of disease mutations (DMDM)

More...
DMDMi
229463026

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002049151 – 1765RANBP2-like and GRIP domain-containing protein 5/6Add BLAST1765

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei19PhosphothreonineCombined sources1
Modified residuei21PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q99666

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q99666

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q99666

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q99666

PeptideAtlas

More...
PeptideAtlasi
Q99666

PRoteomics IDEntifications database

More...
PRIDEi
Q99666

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
78386 [Q99666-1]
78387 [Q99666-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q99666

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q99666

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in testis.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000015568 Expressed in 201 organ(s), highest expression level in testis

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q99666 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q99666 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA045704
HPA049497
HPA051675
HPA067564

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
123954, 51 interactors
609938, 5 interactors

Protein interaction database and analysis system

More...
IntActi
Q99666, 36 interactors

Molecular INTeraction database

More...
MINTi
Q99666

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000330842

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q99666

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section indicates the positions and types of repeated sequence motifs or repeated domains within the protein.<p><a href='/help/repeat' target='_top'>More...</a></p>Repeati26 – 59TPR 1Add BLAST34
Repeati60 – 93TPR 2Add BLAST34
Repeati648 – 681TPR 3Add BLAST34
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini1036 – 1172RanBD1 1PROSITE-ProRule annotationAdd BLAST137
Domaini1333 – 1469RanBD1 2PROSITE-ProRule annotationAdd BLAST137
Domaini1702 – 1752GRIPPROSITE-ProRule annotationAdd BLAST51

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi1261 – 1266Poly-Ser6

Keywords - Domaini

Repeat, TPR repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG0864 Eukaryota
COG5171 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000164065

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000089994

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q99666

Database of Orthologous Groups

More...
OrthoDBi
1339144at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q99666

TreeFam database of animal gene trees

More...
TreeFami
TF314797

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.25.40.10, 1 hit
2.30.29.30, 2 hits

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR032023 GCC2_Rab_bind
IPR000237 GRIP_dom
IPR011993 PH-like_dom_sf
IPR000156 Ran_bind_dom
IPR013026 TPR-contain_dom
IPR011990 TPR-like_helical_dom_sf
IPR019734 TPR_repeat

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF01465 GRIP, 1 hit
PF16704 Rab_bind, 1 hit
PF00638 Ran_BP1, 2 hits

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00755 Grip, 1 hit
SM00160 RanBD, 2 hits
SM00028 TPR, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF48452 SSF48452, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50913 GRIP, 1 hit
PS50196 RANBD1, 2 hits
PS50005 TPR, 1 hit
PS50293 TPR_REGION, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 5 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q99666-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MRRSKADVER YVASVLGLTP SPRQKSMKGF YFAKLYYEAK EYDLAKKYIC
60 70 80 90 100
TYINVQERDP KAHRFLGLLY ELEENTEKAV ECYRRSVELN PTQKDLVLKI
110 120 130 140 150
AELLCKNDVT DGRAKYWVER AAKLFPGSPA IYKLKEQLLD CEGEDGWNKL
160 170 180 190 200
FDLIQSELYV RPDDVHVNIR LVELYRSTKR LKDAVAHCHE AERNIALRSS
210 220 230 240 250
LEWNSCVVQT LKEYLESLQC LESDKSDWQA TNTDLLLAYA NLMLLTLSTR
260 270 280 290 300
DVQENRELLE SFDSALQSAK SSLGGNDELS ATFLEMKGHF YMYAGSLLLK
310 320 330 340 350
MGQHGNNVQW RALSELAALC YLIAFQVPRP KIKLREGKAG QNLLEMMACD
360 370 380 390 400
RLSQSGHMLL SLSRGKQDFL KEVVETFANK IGQSALYDAL FSSQSPKDTS
410 420 430 440 450
FLGSDDIGKI DVQEPELEDL ARYDVGAIRA HNGSLQHLTW LGLQWNSLPA
460 470 480 490 500
LPGIRKWLKQ LFHRLPHETS RLETNAPESI CILDLEVFLL GVVYTSHLQL
510 520 530 540 550
KEKCNSHHSS YQPLCLPFPV CKQLCTERQK SWWDAVCTLI HRKAVPGNLA
560 570 580 590 600
KLRLLVQHEI NTLRAQEKHG LQPALLVHWA KYLQKTGSGL NSFYGQLEYI
610 620 630 640 650
GRSVHYWKKV LPLLKIIKKN SIPEPIDPLF KHFHSVDIQA SEIVEYEEDA
660 670 680 690 700
HITFAMLDAV NGNIEDAVTA FESIKSVVSY WNLALIFHRK AEDIENDALS
710 720 730 740 750
PEEQEECRNY LTKTRDYLIK IIDDGDSNLS VVKKLPVPLE SVKQMLNSVM
760 770 780 790 800
QELEDYSEGG PLYKNGSLRN ADSEIKHSTP SPTKYSLSPS KSYKYSPETP
810 820 830 840 850
PRWTEDRNSL LNMICQQVEA IKKEMQELKL NSSKSASRHR WPTENYGPDS
860 870 880 890 900
VPDGYQGSQT FHGAPLTVAT TGPSVYYSQS PAYNSQYLLR PAANVTPTKG
910 920 930 940 950
SSNTEFKSTK EGFSIPVSAD GFKFGISEPG NQEKKREKPL ENDTGFQAQD
960 970 980 990 1000
ISGRKKGRGV IFGQTSSTFT FADVAKSTSG EGFQFGKKDL NFKGFSGAGE
1010 1020 1030 1040 1050
KLFSSRYGKM ANKANTSGDF EKDDDAYKTE DSDDIHFEPV VQMPEKVELV
1060 1070 1080 1090 1100
TGEEGEKVLY SQGVKLFRFD AEVRQWKERG LGNLKILKNE VNGKLRMLMR
1110 1120 1130 1140 1150
REQVLKVCAN HWITTTMNLK PLSGSDRAWM WSASDFSDGD AKLERLAAKF
1160 1170 1180 1190 1200
KTPELAEEFK QKFEECQRLL LDIPLQTPHK LVDTGRAAKL IQRAEEMKSG
1210 1220 1230 1240 1250
LKDFKTFLTN DQTKVTEEEN KGSGTGAAGA SDTTIKPNAE NTGPTLEWDN
1260 1270 1280 1290 1300
YDLREDALDD SVSSSSVHAS PLASSPVRKN LFRFDESTTG SNFSFKSALS
1310 1320 1330 1340 1350
LSKSPAKLNQ SGTSVGTDEE SVVTQEEERD GQYFEPVVPL PDLVEVSSGE
1360 1370 1380 1390 1400
ENEQVVFSHR AEIYRYDKDV GQWKERGIGD IKILQNYDNK QVRIVMRRDQ
1410 1420 1430 1440 1450
VLKLCANHRI TPDMSLQNMK GTERVWVWTA CDFADGERKV EHLAVRFKLQ
1460 1470 1480 1490 1500
DVADSFKKIF DEAKTAQEKD SLITPHVSRS STPRESPCGK IAVAILEETT
1510 1520 1530 1540 1550
RERTDVIQGD DVADAASEVE VSSTSETTTK AVVSPPKFVF VSESVKRIFS
1560 1570 1580 1590 1600
SEKSKPFVFG NSSATGSLFG FSFNAPLKSN NSETSSVAQS GSESKVEPKK
1610 1620 1630 1640 1650
CELSKNSDIE QSSDSKVKNL SASFPTEESS INYTFKTPEK EPPLWHAEFT
1660 1670 1680 1690 1700
KEELVQKLRS TTKSADHLNG LLREIEATNA VLMEQIKLLK SEIRRLERNQ
1710 1720 1730 1740 1750
EREKSAANLE YLKNVLLQFI FLKPGSERER LLPVINTMLQ LSPEEKGKLA
1760
AVAQDEEENA SRSSG
Length:1,765
Mass (Da):198,924
Last modified:May 5, 2009 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iDC699DC82C67749D
GO
Isoform 2 (identifier: Q99666-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     868-904: VATTGPSVYYSQSPAYNSQYLLRPAANVTPTKGSSNT → EAAHRHFTIEKHGDSKWIIYRFTKQLCGTERARAKIS
     905-1765: Missing.

Show »
Length:904
Mass (Da):103,334
Checksum:i32030C739F6E72EE
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 5 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
C9J6W1C9J6W1_HUMAN
RANBP2-like and GRIP domain-contain...
RGPD8 RGPD5
152Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H7BZ48H7BZ48_HUMAN
RANBP2-like and GRIP domain-contain...
RGPD6
202Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9J1W9C9J1W9_HUMAN
RANBP2-like and GRIP domain-contain...
RGPD5
134Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9JF75C9JF75_HUMAN
RANBP2-like and GRIP domain-contain...
RGPD6
135Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9J1P2C9J1P2_HUMAN
RANBP2-like and GRIP domain-contain...
RGPD6 RGPD5
56Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti174L → V in AAB41848 (PubMed:10101573).Curated1
Sequence conflicti204N → H in AAB41848 (PubMed:10101573).Curated1
Sequence conflicti214Y → H in AAB41848 (PubMed:10101573).Curated1
Sequence conflicti229Q → R in AAB41848 (PubMed:10101573).Curated1
Sequence conflicti257E → G in AAB41848 (PubMed:10101573).Curated1
Sequence conflicti270K → E in AAB41848 (PubMed:10101573).Curated1
Sequence conflicti451L → S in AAB41848 (PubMed:10101573).Curated1
Sequence conflicti736P → S in AAB41848 (PubMed:10101573).Curated1
Sequence conflicti784K → R in AAB41848 (PubMed:10101573).Curated1
Sequence conflicti893A → G in AAB41848 (PubMed:10101573).Curated1
Sequence conflicti905E → D in AAB41848 (PubMed:10101573).Curated1
Sequence conflicti946F → L in AAB41848 (PubMed:10101573).Curated1
Sequence conflicti1074R → S in AAB41848 (PubMed:10101573).Curated1
Sequence conflicti1135D → H in AAB41848 (PubMed:10101573).Curated1
Sequence conflicti1612S → P in AAB41848 (PubMed:10101573).Curated1
Sequence conflicti1682L → P in AAB41848 (PubMed:10101573).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_038968868 – 904VATTG…GSSNT → EAAHRHFTIEKHGDSKWIIY RFTKQLCGTERARAKIS in isoform 2. 1 PublicationAdd BLAST37
Alternative sequenceiVSP_038969905 – 1765Missing in isoform 2. 1 PublicationAdd BLAST861

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
U64675 mRNA Translation: AAB41848.2
AL136868 mRNA Translation: CAB66802.1
AC013271 Genomic DNA Translation: AAY14902.1
AC123886 Genomic DNA Translation: AAY14839.1
AC108938 Genomic DNA Translation: AAY24132.1
AC109815 Genomic DNA No translation available.
AB209082 mRNA Translation: BAD92319.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS2082.1 [Q99666-1]
CCDS2083.1 [Q99666-2]
CCDS42729.1 [Q99666-2]
CCDS46388.1 [Q99666-1]

NCBI Reference Sequences

More...
RefSeqi
NP_001032955.1, NM_001037866.1 [Q99666-2]
NP_001116835.1, NM_001123363.3 [Q99666-1]
NP_005045.2, NM_005054.2 [Q99666-1]
NP_115636.1, NM_032260.2 [Q99666-2]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000016946; ENSP00000016946; ENSG00000015568 [Q99666-1]
ENST00000272454; ENSP00000272454; ENSG00000015568 [Q99666-2]
ENST00000329516; ENSP00000330842; ENSG00000183054 [Q99666-1]
ENST00000330331; ENSP00000330023; ENSG00000183054 [Q99666-2]
ENST00000393283; ENSP00000376962; ENSG00000015568 [Q99666-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
729540
84220

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:729540
hsa:84220

UCSC genome browser

More...
UCSCi
uc002tfc.3 human [Q99666-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U64675 mRNA Translation: AAB41848.2
AL136868 mRNA Translation: CAB66802.1
AC013271 Genomic DNA Translation: AAY14902.1
AC123886 Genomic DNA Translation: AAY14839.1
AC108938 Genomic DNA Translation: AAY24132.1
AC109815 Genomic DNA No translation available.
AB209082 mRNA Translation: BAD92319.1
CCDSiCCDS2082.1 [Q99666-1]
CCDS2083.1 [Q99666-2]
CCDS42729.1 [Q99666-2]
CCDS46388.1 [Q99666-1]
RefSeqiNP_001032955.1, NM_001037866.1 [Q99666-2]
NP_001116835.1, NM_001123363.3 [Q99666-1]
NP_005045.2, NM_005054.2 [Q99666-1]
NP_115636.1, NM_032260.2 [Q99666-2]

3D structure databases

SMRiQ99666
ModBaseiSearch...

Protein-protein interaction databases

BioGridi123954, 51 interactors
609938, 5 interactors
IntActiQ99666, 36 interactors
MINTiQ99666
STRINGi9606.ENSP00000330842

PTM databases

iPTMnetiQ99666
PhosphoSitePlusiQ99666

Polymorphism and mutation databases

BioMutaiRGPD5
DMDMi229463026

Proteomic databases

EPDiQ99666
jPOSTiQ99666
MassIVEiQ99666
PaxDbiQ99666
PeptideAtlasiQ99666
PRIDEiQ99666
ProteomicsDBi78386 [Q99666-1]
78387 [Q99666-2]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
729540
84220

Genome annotation databases

EnsembliENST00000016946; ENSP00000016946; ENSG00000015568 [Q99666-1]
ENST00000272454; ENSP00000272454; ENSG00000015568 [Q99666-2]
ENST00000329516; ENSP00000330842; ENSG00000183054 [Q99666-1]
ENST00000330331; ENSP00000330023; ENSG00000183054 [Q99666-2]
ENST00000393283; ENSP00000376962; ENSG00000015568 [Q99666-2]
GeneIDi729540
84220
KEGGihsa:729540
hsa:84220
UCSCiuc002tfc.3 human [Q99666-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
729540
84220

GeneCards: human genes, protein and diseases

More...
GeneCardsi
RGPD5
RGPD6
HGNCiHGNC:32418 RGPD5
HGNC:32419 RGPD6
HPAiHPA045704
HPA049497
HPA051675
HPA067564
MIMi612708 gene
612709 gene
612710 gene
neXtProtiNX_Q99666
OpenTargetsiENSG00000015568
PharmGKBiPA142671074

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG0864 Eukaryota
COG5171 LUCA
GeneTreeiENSGT00940000164065
HOGENOMiHOG000089994
InParanoidiQ99666
OrthoDBi1339144at2759
PhylomeDBiQ99666
TreeFamiTF314797

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
RGPD5 human
RGPD6 human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
RGPD5
PharosiQ99666

Protein Ontology

More...
PROi
PR:Q99666

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000015568 Expressed in 201 organ(s), highest expression level in testis
ExpressionAtlasiQ99666 baseline and differential
GenevisibleiQ99666 HS

Family and domain databases

Gene3Di1.25.40.10, 1 hit
2.30.29.30, 2 hits
InterProiView protein in InterPro
IPR032023 GCC2_Rab_bind
IPR000237 GRIP_dom
IPR011993 PH-like_dom_sf
IPR000156 Ran_bind_dom
IPR013026 TPR-contain_dom
IPR011990 TPR-like_helical_dom_sf
IPR019734 TPR_repeat
PfamiView protein in Pfam
PF01465 GRIP, 1 hit
PF16704 Rab_bind, 1 hit
PF00638 Ran_BP1, 2 hits
SMARTiView protein in SMART
SM00755 Grip, 1 hit
SM00160 RanBD, 2 hits
SM00028 TPR, 1 hit
SUPFAMiSSF48452 SSF48452, 1 hit
PROSITEiView protein in PROSITE
PS50913 GRIP, 1 hit
PS50196 RANBD1, 2 hits
PS50005 TPR, 1 hit
PS50293 TPR_REGION, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiRGPD5_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q99666
Secondary accession number(s): Q53QN2
, Q53T03, Q59GM7, Q9H0B2
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: December 6, 2005
Last sequence update: May 5, 2009
Last modified: September 18, 2019
This is version 157 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again