Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Kinesin-like protein KIF2C

Gene

KIF2C

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

In complex with KIF18B, constitutes the major microtubule plus-end depolymerizing activity in mitotic cells (PubMed:21820309). Regulates the turnover of microtubules at the kinetochore and functions in chromosome segregation during mitosis (PubMed:19060894). Plays a role in chromosome congression and is required for the lateral to end-on conversion of the chromosome-microtubule attachment (PubMed:23891108).3 Publications

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Binding sitei264ATPBy similarity1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Nucleotide bindingi348 – 355ATP8

GO - Molecular functioni

  • ATPase activity Source: GO_Central
  • ATP binding Source: UniProtKB-KW
  • centromeric DNA binding Source: ProtInc
  • microtubule binding Source: GO_Central
  • microtubule motor activity Source: GO_Central
  • microtubule plus-end binding Source: UniProtKB

GO - Biological processi

Keywordsi

Biological processCell cycle, Cell division, Chromosome partition, Mitosis
LigandATP-binding, Nucleotide-binding

Enzyme and pathway databases

ReactomeiR-HSA-141444 Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal
R-HSA-2132295 MHC class II antigen presentation
R-HSA-2467813 Separation of Sister Chromatids
R-HSA-2500257 Resolution of Sister Chromatid Cohesion
R-HSA-5663220 RHO GTPases Activate Formins
R-HSA-6811434 COPI-dependent Golgi-to-ER retrograde traffic
R-HSA-68877 Mitotic Prometaphase
R-HSA-983189 Kinesins
SIGNORiQ99661

Names & Taxonomyi

Protein namesi
Recommended name:
Kinesin-like protein KIF2C
Alternative name(s):
Kinesin-like protein 6
Mitotic centromere-associated kinesin
Short name:
MCAK
Gene namesi
Name:KIF2C
Synonyms:KNSL6
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 1

Organism-specific databases

EuPathDBiHostDB:ENSG00000142945.12
HGNCiHGNC:6393 KIF2C
MIMi604538 gene
neXtProtiNX_Q99661

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Centromere, Chromosome, Cytoplasm, Cytoskeleton, Kinetochore, Microtubule, Nucleus

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi95S → E: Alters interaction with MAPRE1 and association with microtubule growing ends; when associated with E-109 and E-111. 1 Publication1
Mutagenesisi100 – 101IP → NN: Loss of interaction with MAPRE1 and association with microtubule growing ends. 1 Publication2
Mutagenesisi109S → E: Alters interaction with MAPRE1 and association with microtubule growing ends; when associated with E-95 and E-111. 1 Publication1
Mutagenesisi111S → E: Alters interaction with MAPRE1 and association with microtubule growing ends; when associated with E-95 and E-109. 1 Publication1

Organism-specific databases

DisGeNETi11004
OpenTargetsiENSG00000142945
PharmGKBiPA30182

Chemistry databases

ChEMBLiCHEMBL5967
DrugBankiDB04395 Phosphoaminophosphonic Acid-Adenylate Ester

Polymorphism and mutation databases

BioMutaiKIF2C
DMDMi20141607

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Initiator methionineiRemovedCombined sources
ChainiPRO_00001254182 – 725Kinesin-like protein KIF2CAdd BLAST724

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei2N-acetylalanineCombined sources1
Modified residuei6PhosphoserineCombined sources1
Modified residuei22PhosphoserineCombined sources1
Modified residuei95Phosphoserine; by AURKB1 Publication1
Modified residuei106PhosphoserineCombined sources1
Modified residuei109PhosphoserineBy similarity1
Modified residuei111PhosphoserineBy similarity1
Modified residuei115PhosphoserineCombined sources1
Modified residuei166PhosphoserineCombined sources1
Modified residuei175PhosphoserineCombined sources1
Modified residuei187PhosphoserineCombined sources1
Modified residuei192PhosphoserineBy similarity1
Modified residuei519PhosphoserineCombined sources1
Modified residuei621PhosphoserineCombined sources1
Modified residuei633PhosphoserineCombined sources1

Post-translational modificationi

Phosphorylation by AURKB, regulates association with centromeres and kinetochores and the microtubule depolymerization activity.1 Publication
Ubiquitinated.1 Publication

Keywords - PTMi

Acetylation, Phosphoprotein, Ubl conjugation

Proteomic databases

EPDiQ99661
MaxQBiQ99661
PaxDbiQ99661
PeptideAtlasiQ99661
PRIDEiQ99661
ProteomicsDBi78382
78383 [Q99661-2]

PTM databases

iPTMnetiQ99661
PhosphoSitePlusiQ99661

Expressioni

Tissue specificityi

Expressed at high levels in thymus and testis, at low levels in small intestine, the mucosal lining of colon, and placenta, and at very low levels in spleen and ovary; expression is not detected in prostate, peripheral blood Leukocytes, heart, brain, lung, liver, skeletal muscle, kidney or pancreas. Isoform 2 is testis-specific.2 Publications

Developmental stagei

Isoform 2 is expressed in fetal testis.1 Publication

Gene expression databases

BgeeiENSG00000142945 Expressed in 145 organ(s), highest expression level in testis
CleanExiHS_KIF2C
ExpressionAtlasiQ99661 baseline and differential
GenevisibleiQ99661 HS

Organism-specific databases

HPAiHPA006219

Interactioni

Subunit structurei

Interacts with CENPH. Interacts with MTUS2/TIP150; the interaction is direct. Interacts with MAPRE1; the interaction is direct, regulated by phosphorylation and is probably required for targeting to growing microtubule plus ends. Interacts with KIF18B at microtubule tips; this interaction increases the affinity of both partners for microtubule plus ends and is required for robust microtubule depolymerization. Phosphorylation by AURKA or AURKB strongly reduces KIF18B-binding.5 Publications

Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

BioGridi116195, 83 interactors
ELMiQ99661
IntActiQ99661, 46 interactors
MINTiQ99661
STRINGi9606.ENSP00000361298

Chemistry databases

BindingDBiQ99661

Structurei

Secondary structure

1725
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

ProteinModelPortaliQ99661
SMRiQ99661
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ99661

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini258 – 588Kinesin motorPROSITE-ProRule annotationAdd BLAST331

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni2 – 254GlobularSequence analysisAdd BLAST253
Regioni207 – 238Negative regulator of microtubule-bindingBy similarityAdd BLAST32

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili618 – 658Sequence analysisAdd BLAST41

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Motifi98 – 101Microtubule tip localization signal4
Motifi415 – 418Nuclear localization signalSequence analysis4

Domaini

The microtubule tip localization signal (MtLS) motif; mediates interaction with MAPRE1 and targeting to the growing microtubule plus ends.1 Publication

Sequence similaritiesi

Belongs to the TRAFAC class myosin-kinesin ATPase superfamily. Kinesin family. MCAK/KIF2 subfamily.PROSITE-ProRule annotation

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiKOG0246 Eukaryota
COG5059 LUCA
GeneTreeiENSGT00930000150912
HOVERGENiHBG003875
InParanoidiQ99661
KOiK10393
OMAiIQQGPGW
OrthoDBiEOG091G06V3
PhylomeDBiQ99661
TreeFamiTF105222

Family and domain databases

Gene3Di3.40.850.10, 1 hit
InterProiView protein in InterPro
IPR027640 Kinesin-like_fam
IPR019821 Kinesin_motor_CS
IPR001752 Kinesin_motor_dom
IPR036961 Kinesin_motor_dom_sf
IPR027417 P-loop_NTPase
PANTHERiPTHR24115 PTHR24115, 1 hit
PfamiView protein in Pfam
PF00225 Kinesin, 1 hit
PRINTSiPR00380 KINESINHEAVY
SMARTiView protein in SMART
SM00129 KISc, 1 hit
SUPFAMiSSF52540 SSF52540, 1 hit
PROSITEiView protein in PROSITE
PS00411 KINESIN_MOTOR_1, 1 hit
PS50067 KINESIN_MOTOR_2, 1 hit

Sequences (2+)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q99661-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAMDSSLQAR LFPGLAIKIQ RSNGLIHSAN VRTVNLEKSC VSVEWAEGGA
60 70 80 90 100
TKGKEIDFDD VAAINPELLQ LLPLHPKDNL PLQENVTIQK QKRRSVNSKI
110 120 130 140 150
PAPKESLRSR STRMSTVSEL RITAQENDME VELPAAANSR KQFSVPPAPT
160 170 180 190 200
RPSCPAVAEI PLRMVSEEME EQVHSIRGSS SANPVNSVRR KSCLVKEVEK
210 220 230 240 250
MKNKREEKKA QNSEMRMKRA QEYDSSFPNW EFARMIKEFR ATLECHPLTM
260 270 280 290 300
TDPIEEHRIC VCVRKRPLNK QELAKKEIDV ISIPSKCLLL VHEPKLKVDL
310 320 330 340 350
TKYLENQAFC FDFAFDETAS NEVVYRFTAR PLVQTIFEGG KATCFAYGQT
360 370 380 390 400
GSGKTHTMGG DLSGKAQNAS KGIYAMASRD VFLLKNQPCY RKLGLEVYVT
410 420 430 440 450
FFEIYNGKLF DLLNKKAKLR VLEDGKQQVQ VVGLQEHLVN SADDVIKMID
460 470 480 490 500
MGSACRTSGQ TFANSNSSRS HACFQIILRA KGRMHGKFSL VDLAGNERGA
510 520 530 540 550
DTSSADRQTR MEGAEINKSL LALKECIRAL GQNKAHTPFR ESKLTQVLRD
560 570 580 590 600
SFIGENSRTC MIATISPGIS SCEYTLNTLR YADRVKELSP HSGPSGEQLI
610 620 630 640 650
QMETEEMEAC SNGALIPGNL SKEEEELSSQ MSSFNEAMTQ IRELEEKAME
660 670 680 690 700
ELKEIIQQGP DWLELSEMTE QPDYDLETFV NKAESALAQQ AKHFSALRDV
710 720
IKALRLAMQL EEQASRQISS KKRPQ
Length:725
Mass (Da):81,313
Last modified:January 23, 2002 - v2
Checksum:i5BDECC133AB4B55C
GO
Isoform 2 (identifier: Q99661-2) [UniParc]FASTAAdd to basket
Also known as: tsMCAK

The sequence of this isoform differs from the canonical sequence as follows:
     1-55: MAMDSSLQARLFPGLAIKIQRSNGLIHSANVRTVNLEKSCVSVEWAEGGATKGKE → M

Show »
Length:671
Mass (Da):75,561
Checksum:i6A493B16911472C8
GO

Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
Q5JR91Q5JR91_HUMAN
Kinesin-like protein KIF2C
KIF2C
336Annotation score:
Q5JR89Q5JR89_HUMAN
Kinesin-like protein KIF2C
KIF2C
287Annotation score:
H0Y5Z9H0Y5Z9_HUMAN
Kinesin-like protein KIF2C
KIF2C
107Annotation score:

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti698R → P in AAH08764 (PubMed:15489334).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_049683449I → L3 PublicationsCorresponds to variant dbSNP:rs4342887Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0028661 – 55MAMDS…TKGKE → M in isoform 2. 1 PublicationAdd BLAST55

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U63743 mRNA Translation: AAC27660.1
AY026505 mRNA Translation: AAK20168.1
BT006759 mRNA Translation: AAP35405.1
CR450302 mRNA Translation: CAG29298.1
AB264115 mRNA Translation: BAG50306.1
AL592166 Genomic DNA No translation available.
CH471059 Genomic DNA Translation: EAX07025.1
BC008764 mRNA Translation: AAH08764.1
BC014924 mRNA Translation: AAH14924.1
CCDSiCCDS512.1 [Q99661-1]
CCDS72774.1 [Q99661-2]
RefSeqiNP_001284584.1, NM_001297655.1
NP_001284585.1, NM_001297656.1 [Q99661-2]
NP_001284586.1, NM_001297657.1
NP_006836.2, NM_006845.3 [Q99661-1]
UniGeneiHs.720061

Genome annotation databases

EnsembliENST00000372217; ENSP00000361291; ENSG00000142945 [Q99661-2]
ENST00000372224; ENSP00000361298; ENSG00000142945 [Q99661-1]
GeneIDi11004
KEGGihsa:11004
UCSCiuc001cmg.5 human [Q99661-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U63743 mRNA Translation: AAC27660.1
AY026505 mRNA Translation: AAK20168.1
BT006759 mRNA Translation: AAP35405.1
CR450302 mRNA Translation: CAG29298.1
AB264115 mRNA Translation: BAG50306.1
AL592166 Genomic DNA No translation available.
CH471059 Genomic DNA Translation: EAX07025.1
BC008764 mRNA Translation: AAH08764.1
BC014924 mRNA Translation: AAH14924.1
CCDSiCCDS512.1 [Q99661-1]
CCDS72774.1 [Q99661-2]
RefSeqiNP_001284584.1, NM_001297655.1
NP_001284585.1, NM_001297656.1 [Q99661-2]
NP_001284586.1, NM_001297657.1
NP_006836.2, NM_006845.3 [Q99661-1]
UniGeneiHs.720061

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2HEHX-ray2.15A225-593[»]
4UBFX-ray3.00A/B/C/D225-593[»]
P709-720[»]
4Y05X-ray2.59A216-599[»]
5MIOX-ray3.19C216-598[»]
ProteinModelPortaliQ99661
SMRiQ99661
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi116195, 83 interactors
ELMiQ99661
IntActiQ99661, 46 interactors
MINTiQ99661
STRINGi9606.ENSP00000361298

Chemistry databases

BindingDBiQ99661
ChEMBLiCHEMBL5967
DrugBankiDB04395 Phosphoaminophosphonic Acid-Adenylate Ester

PTM databases

iPTMnetiQ99661
PhosphoSitePlusiQ99661

Polymorphism and mutation databases

BioMutaiKIF2C
DMDMi20141607

Proteomic databases

EPDiQ99661
MaxQBiQ99661
PaxDbiQ99661
PeptideAtlasiQ99661
PRIDEiQ99661
ProteomicsDBi78382
78383 [Q99661-2]

Protocols and materials databases

DNASUi11004
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000372217; ENSP00000361291; ENSG00000142945 [Q99661-2]
ENST00000372224; ENSP00000361298; ENSG00000142945 [Q99661-1]
GeneIDi11004
KEGGihsa:11004
UCSCiuc001cmg.5 human [Q99661-1]

Organism-specific databases

CTDi11004
DisGeNETi11004
EuPathDBiHostDB:ENSG00000142945.12
GeneCardsiKIF2C
HGNCiHGNC:6393 KIF2C
HPAiHPA006219
MIMi604538 gene
neXtProtiNX_Q99661
OpenTargetsiENSG00000142945
PharmGKBiPA30182
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG0246 Eukaryota
COG5059 LUCA
GeneTreeiENSGT00930000150912
HOVERGENiHBG003875
InParanoidiQ99661
KOiK10393
OMAiIQQGPGW
OrthoDBiEOG091G06V3
PhylomeDBiQ99661
TreeFamiTF105222

Enzyme and pathway databases

ReactomeiR-HSA-141444 Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal
R-HSA-2132295 MHC class II antigen presentation
R-HSA-2467813 Separation of Sister Chromatids
R-HSA-2500257 Resolution of Sister Chromatid Cohesion
R-HSA-5663220 RHO GTPases Activate Formins
R-HSA-6811434 COPI-dependent Golgi-to-ER retrograde traffic
R-HSA-68877 Mitotic Prometaphase
R-HSA-983189 Kinesins
SIGNORiQ99661

Miscellaneous databases

ChiTaRSiKIF2C human
EvolutionaryTraceiQ99661
GeneWikiiKIF2C
GenomeRNAii11004
PROiPR:Q99661
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000142945 Expressed in 145 organ(s), highest expression level in testis
CleanExiHS_KIF2C
ExpressionAtlasiQ99661 baseline and differential
GenevisibleiQ99661 HS

Family and domain databases

Gene3Di3.40.850.10, 1 hit
InterProiView protein in InterPro
IPR027640 Kinesin-like_fam
IPR019821 Kinesin_motor_CS
IPR001752 Kinesin_motor_dom
IPR036961 Kinesin_motor_dom_sf
IPR027417 P-loop_NTPase
PANTHERiPTHR24115 PTHR24115, 1 hit
PfamiView protein in Pfam
PF00225 Kinesin, 1 hit
PRINTSiPR00380 KINESINHEAVY
SMARTiView protein in SMART
SM00129 KISc, 1 hit
SUPFAMiSSF52540 SSF52540, 1 hit
PROSITEiView protein in PROSITE
PS00411 KINESIN_MOTOR_1, 1 hit
PS50067 KINESIN_MOTOR_2, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiKIF2C_HUMAN
AccessioniPrimary (citable) accession number: Q99661
Secondary accession number(s): B3ITR9
, Q5JR88, Q6ICU1, Q96C18, Q96HB8, Q9BWV8
Entry historyiIntegrated into UniProtKB/Swiss-Prot: January 11, 2001
Last sequence update: January 23, 2002
Last modified: November 7, 2018
This is version 189 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  6. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again