Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - Q99661 (KIF2C_HUMAN)

Entry version 207 (10 Feb 2021)
Sequence version 2 (23 Jan 2002)
Previous versions | rss
Add a publicationFeedback
Protein

Kinesin-like protein KIF2C

Gene

KIF2C

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

In complex with KIF18B, constitutes the major microtubule plus-end depolymerizing activity in mitotic cells (PubMed:21820309). Regulates the turnover of microtubules at the kinetochore and functions in chromosome segregation during mitosis (PubMed:19060894). Plays a role in chromosome congression and is required for the lateral to end-on conversion of the chromosome-microtubule attachment (PubMed:23891108).3 Publications

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes the interaction between a single amino acid and another chemical entity. Priority is given to the annotation of physiological ligands.<p><a href='/help/binding' target='_top'>More...</a></p>Binding sitei264ATPBy similarity1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes a region in the protein which binds nucleotide phosphates. It always involves more than one amino acid and includes all residues involved in nucleotide-binding.<p><a href='/help/np_bind' target='_top'>More...</a></p>Nucleotide bindingi348 – 355ATP8

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processCell cycle, Cell division, Chromosome partition, Mitosis
LigandATP-binding, Nucleotide-binding

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		Q99661

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-141444, Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal
R-HSA-2132295, MHC class II antigen presentation
R-HSA-2467813, Separation of Sister Chromatids
R-HSA-2500257, Resolution of Sister Chromatid Cohesion
R-HSA-5663220, RHO GTPases Activate Formins
R-HSA-6811434, COPI-dependent Golgi-to-ER retrograde traffic
R-HSA-68877, Mitotic Prometaphase
R-HSA-9648025, EML4 and NUDC in mitotic spindle formation
R-HSA-983189, Kinesins

SIGNOR Signaling Network Open Resource

More...SIGNORi		Q99661

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Kinesin-like protein KIF2C
Alternative name(s):
Kinesin-like protein 6
Mitotic centromere-associated kinesin
Short name:
MCAK
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:KIF2C
Synonyms:KNSL6
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 1

Organism-specific databases

Human Gene Nomenclature Database

More...HGNCi		HGNC:6393, KIF2C

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		604538, gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_Q99661

Eukaryotic Pathogen, Vector and Host Database Resources

More...VEuPathDBi		HostDB:ENSG00000142945.12

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Centromere, Chromosome, Cytoplasm, Cytoskeleton, Kinetochore, Microtubule, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology%5Fand%5Fbiotech%5Fsection">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi95S → E: Alters interaction with MAPRE1 and association with microtubule growing ends; when associated with E-109 and E-111. 1 Publication1
Mutagenesisi100 – 101IP → NN: Loss of interaction with MAPRE1 and association with microtubule growing ends. 1 Publication2
Mutagenesisi109S → E: Alters interaction with MAPRE1 and association with microtubule growing ends; when associated with E-95 and E-111. 1 Publication1
Mutagenesisi111S → E: Alters interaction with MAPRE1 and association with microtubule growing ends; when associated with E-95 and E-109. 1 Publication1

Organism-specific databases

DisGeNET

More...DisGeNETi		11004

Open Targets

More...OpenTargetsi		ENSG00000142945

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA30182

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		Q99661, Tbio

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...ChEMBLi		CHEMBL5967

Drug and drug target database

More...DrugBanki		DB04395, Phosphoaminophosphonic Acid-Adenylate Ester

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		KIF2C

Domain mapping of disease mutations (DMDM)

More...DMDMi		20141607

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section indicates that the initiator methionine is cleaved from the mature protein.<p><a href='/help/init_met' target='_top'>More...</a></p>Initiator methionineiRemovedCombined sources
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001254182 – 725Kinesin-like protein KIF2CAdd BLAST724

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei2N-acetylalanineCombined sources1
Modified residuei6PhosphoserineCombined sources1
Modified residuei22PhosphoserineCombined sources1
Modified residuei95Phosphoserine; by AURKB1 Publication1
Modified residuei106PhosphoserineCombined sources1
Modified residuei109PhosphoserineBy similarity1
Modified residuei111PhosphoserineBy similarity1
Modified residuei115PhosphoserineCombined sources1
Modified residuei166PhosphoserineCombined sources1
Modified residuei175PhosphoserineCombined sources1
Modified residuei187PhosphoserineCombined sources1
Modified residuei192PhosphoserineBy similarity1
Modified residuei519PhosphoserineCombined sources1
Modified residuei621PhosphoserineCombined sources1
Modified residuei633PhosphoserineCombined sources1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Phosphorylation by AURKB, regulates association with centromeres and kinetochores and the microtubule depolymerization activity.1 Publication
Ubiquitinated.1 Publication

Keywords - PTMi

Acetylation, Phosphoprotein, Ubl conjugation

Proteomic databases

Encyclopedia of Proteome Dynamics

More...EPDi		Q99661

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		Q99661

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		Q99661

MaxQB - The MaxQuant DataBase

More...MaxQBi		Q99661

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q99661

PeptideAtlas

More...PeptideAtlasi		Q99661

PRoteomics IDEntifications database

More...PRIDEi		Q99661

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		78382 [Q99661-1]
78383 [Q99661-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q99661

MetOSite database of methionine sulfoxide sites

More...MetOSitei		Q99661

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q99661

SwissPalm database of S-palmitoylation events

More...SwissPalmi		Q99661

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed at high levels in thymus and testis, at low levels in small intestine, the mucosal lining of colon, and placenta, and at very low levels in spleen and ovary; expression is not detected in prostate, peripheral blood Leukocytes, heart, brain, lung, liver, skeletal muscle, kidney or pancreas. Isoform 2 is testis-specific.2 Publications

<p>This subsection of the 'Expression' section provides information on the expression of the gene product at various stages of a cell, tissue or organism development. By default, the information is derived from experiments at the mRNA level, unless specified 'at the protein level'.<p><a href='/help/developmental_stage' target='_top'>More...</a></p>Developmental stagei

Isoform 2 is expressed in fetal testis.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000142945, Expressed in testis and 159 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		Q99661, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q99661, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000142945, Tissue enhanced (lymphoid tissue, testis)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with CENPH.

Interacts with MTUS2/TIP150; the interaction is direct.

Interacts with MAPRE1; the interaction is direct, regulated by phosphorylation and is probably required for targeting to growing microtubule plus ends.

Interacts with KIF18B at microtubule tips; this interaction increases the affinity of both partners for microtubule plus ends and is required for robust microtubule depolymerization. Phosphorylation by AURKA or AURKB strongly reduces KIF18B-binding.

5 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

GO - Molecular functioni

Complete GO annotation on QuickGO ...

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		116195, 101 interactors

The Eukaryotic Linear Motif resource for Functional Sites in Proteins

More...ELMi		Q99661

Protein interaction database and analysis system

More...IntActi		Q99661, 61 interactors

Molecular INTeraction database

More...MINTi		Q99661

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000361298

Chemistry databases

BindingDB database of measured binding affinities

More...BindingDBi		Q99661

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		Q99661, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1725
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		Q99661

Database of comparative protein structure models

More...ModBasei		Search...

Protein Data Bank in Europe - Knowledge Base

More...PDBe-KBi		Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...EvolutionaryTracei		Q99661

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini258 – 588Kinesin motorPROSITE-ProRule annotationAdd BLAST331

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni2 – 254GlobularSequence analysisAdd BLAST253
Regioni207 – 238Negative regulator of microtubule-bindingBy similarityAdd BLAST32

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and domains' section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili618 – 658Sequence analysisAdd BLAST41

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi98 – 101Microtubule tip localization signal4
Motifi415 – 418Nuclear localization signalSequence analysis4

<p>This subsection of the 'Family and domains' section provides general information on the biological role of a domain. The term 'domain' is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The microtubule tip localization signal (MtLS) motif; mediates interaction with MAPRE1 and targeting to the growing microtubule plus ends.1 Publication

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the TRAFAC class myosin-kinesin ATPase superfamily. Kinesin family. MCAK/KIF2 subfamily.PROSITE-ProRule annotation

Keywords - Domaini

Coiled coil

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG0246, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00940000154046

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_001485_19_1_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q99661

Identification of Orthologs from Complete Genome Data

More...OMAi		RTTLECH

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q99661

TreeFam database of animal gene trees

More...TreeFami		TF105222

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...Gene3Di		3.40.850.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR027640, Kinesin-like_fam
IPR019821, Kinesin_motor_CS
IPR001752, Kinesin_motor_dom
IPR036961, Kinesin_motor_dom_sf
IPR027417, P-loop_NTPase

The PANTHER Classification System

More...PANTHERi		PTHR24115, PTHR24115, 1 hit

Pfam protein domain database

More...Pfami		View protein in Pfam
PF00225, Kinesin, 1 hit

Protein Motif fingerprint database; a protein domain database

More...PRINTSi		PR00380, KINESINHEAVY

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00129, KISc, 1 hit

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF52540, SSF52540, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS00411, KINESIN_MOTOR_1, 1 hit
PS50067, KINESIN_MOTOR_2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q99661-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAMDSSLQAR LFPGLAIKIQ RSNGLIHSAN VRTVNLEKSC VSVEWAEGGA 
        60         70         80         90        100
TKGKEIDFDD VAAINPELLQ LLPLHPKDNL PLQENVTIQK QKRRSVNSKI 
       110        120        130        140        150
PAPKESLRSR STRMSTVSEL RITAQENDME VELPAAANSR KQFSVPPAPT 
       160        170        180        190        200
RPSCPAVAEI PLRMVSEEME EQVHSIRGSS SANPVNSVRR KSCLVKEVEK 
       210        220        230        240        250
MKNKREEKKA QNSEMRMKRA QEYDSSFPNW EFARMIKEFR ATLECHPLTM 
       260        270        280        290        300
TDPIEEHRIC VCVRKRPLNK QELAKKEIDV ISIPSKCLLL VHEPKLKVDL 
       310        320        330        340        350
TKYLENQAFC FDFAFDETAS NEVVYRFTAR PLVQTIFEGG KATCFAYGQT 
       360        370        380        390        400
GSGKTHTMGG DLSGKAQNAS KGIYAMASRD VFLLKNQPCY RKLGLEVYVT 
       410        420        430        440        450
FFEIYNGKLF DLLNKKAKLR VLEDGKQQVQ VVGLQEHLVN SADDVIKMID 
       460        470        480        490        500
MGSACRTSGQ TFANSNSSRS HACFQIILRA KGRMHGKFSL VDLAGNERGA 
       510        520        530        540        550
DTSSADRQTR MEGAEINKSL LALKECIRAL GQNKAHTPFR ESKLTQVLRD 
       560        570        580        590        600
SFIGENSRTC MIATISPGIS SCEYTLNTLR YADRVKELSP HSGPSGEQLI 
       610        620        630        640        650
QMETEEMEAC SNGALIPGNL SKEEEELSSQ MSSFNEAMTQ IRELEEKAME 
       660        670        680        690        700
ELKEIIQQGP DWLELSEMTE QPDYDLETFV NKAESALAQQ AKHFSALRDV 
       710        720 
IKALRLAMQL EEQASRQISS KKRPQ
Length:725
Mass (Da):81,313
Last modified:January 23, 2002 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i5BDECC133AB4B55C
GO
Isoform 2 (identifier: Q99661-2) [UniParc]FASTAAdd to basket
Also known as: tsMCAK

The sequence of this isoform differs from the canonical sequence as follows:
     1-55: MAMDSSLQARLFPGLAIKIQRSNGLIHSANVRTVNLEKSCVSVEWAEGGATKGKE → M

Show »
Length:671
Mass (Da):75,561
Checksum:i6A493B16911472C8
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
Q5JR91Q5JR91_HUMAN
Kinesin-like protein KIF2C
KIF2C
336Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
Q5JR89Q5JR89_HUMAN
Kinesin-like protein KIF2C
KIF2C
287Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0Y5Z9H0Y5Z9_HUMAN
Kinesin-like protein KIF2C
KIF2C
107Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti698R → P in AAH08764 (PubMed:15489334).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_049683449I → L3 PublicationsCorresponds to variant dbSNP:rs4342887Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0028661 – 55MAMDS…TKGKE → M in isoform 2. 1 PublicationAdd BLAST55

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
U63743 mRNA Translation: AAC27660.1
AY026505 mRNA Translation: AAK20168.1
BT006759 mRNA Translation: AAP35405.1
CR450302 mRNA Translation: CAG29298.1
AB264115 mRNA Translation: BAG50306.1
AL592166 Genomic DNA No translation available.
CH471059 Genomic DNA Translation: EAX07025.1
BC008764 mRNA Translation: AAH08764.1
BC014924 mRNA Translation: AAH14924.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS512.1 [Q99661-1]
CCDS72774.1 [Q99661-2]

NCBI Reference Sequences

More...RefSeqi		NP_001284584.1, NM_001297655.1
NP_001284585.1, NM_001297656.1 [Q99661-2]
NP_001284586.1, NM_001297657.1
NP_006836.2, NM_006845.3 [Q99661-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000372217; ENSP00000361291; ENSG00000142945 [Q99661-2]
ENST00000372224; ENSP00000361298; ENSG00000142945 [Q99661-1]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		11004

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:11004

UCSC genome browser

More...UCSCi		uc001cmg.5, human [Q99661-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U63743 mRNA Translation: AAC27660.1
AY026505 mRNA Translation: AAK20168.1
BT006759 mRNA Translation: AAP35405.1
CR450302 mRNA Translation: CAG29298.1
AB264115 mRNA Translation: BAG50306.1
AL592166 Genomic DNA No translation available.
CH471059 Genomic DNA Translation: EAX07025.1
BC008764 mRNA Translation: AAH08764.1
BC014924 mRNA Translation: AAH14924.1
CCDSiCCDS512.1 [Q99661-1]
CCDS72774.1 [Q99661-2]
RefSeqiNP_001284584.1, NM_001297655.1
NP_001284585.1, NM_001297656.1 [Q99661-2]
NP_001284586.1, NM_001297657.1
NP_006836.2, NM_006845.3 [Q99661-1]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...PDBei

Protein Data Bank RCSB

More...RCSB PDBi

Protein Data Bank Japan

More...PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2HEHX-ray2.15A225-593[»]
4UBFX-ray3.00A/B/C/D225-593[»]
P709-720[»]
4Y05X-ray2.59A216-599[»]
5MIOX-ray3.19C216-598[»]
SMRiQ99661
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGRIDi116195, 101 interactors
ELMiQ99661
IntActiQ99661, 61 interactors
MINTiQ99661
STRINGi9606.ENSP00000361298

Chemistry databases

BindingDBiQ99661
ChEMBLiCHEMBL5967
DrugBankiDB04395, Phosphoaminophosphonic Acid-Adenylate Ester

PTM databases

iPTMnetiQ99661
MetOSiteiQ99661
PhosphoSitePlusiQ99661
SwissPalmiQ99661

Genetic variation databases

BioMutaiKIF2C
DMDMi20141607

Proteomic databases

EPDiQ99661
jPOSTiQ99661
MassIVEiQ99661
MaxQBiQ99661
PaxDbiQ99661
PeptideAtlasiQ99661
PRIDEiQ99661
ProteomicsDBi78382 [Q99661-1]
78383 [Q99661-2]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		1212, 365 antibodies

The CPTC Antibody Portal

More...CPTCi		Q99661, 3 antibodies

The DNASU plasmid repository

More...DNASUi		11004

Genome annotation databases

EnsembliENST00000372217; ENSP00000361291; ENSG00000142945 [Q99661-2]
ENST00000372224; ENSP00000361298; ENSG00000142945 [Q99661-1]
GeneIDi11004
KEGGihsa:11004
UCSCiuc001cmg.5, human [Q99661-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		11004
DisGeNETi11004

GeneCards: human genes, protein and diseases

More...GeneCardsi		KIF2C
HGNCiHGNC:6393, KIF2C
HPAiENSG00000142945, Tissue enhanced (lymphoid tissue, testis)
MIMi604538, gene
neXtProtiNX_Q99661
OpenTargetsiENSG00000142945
PharmGKBiPA30182
VEuPathDBiHostDB:ENSG00000142945.12

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG0246, Eukaryota
GeneTreeiENSGT00940000154046
HOGENOMiCLU_001485_19_1_1
InParanoidiQ99661
OMAiRTTLECH
PhylomeDBiQ99661
TreeFamiTF105222

Enzyme and pathway databases

PathwayCommonsiQ99661
ReactomeiR-HSA-141444, Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal
R-HSA-2132295, MHC class II antigen presentation
R-HSA-2467813, Separation of Sister Chromatids
R-HSA-2500257, Resolution of Sister Chromatid Cohesion
R-HSA-5663220, RHO GTPases Activate Formins
R-HSA-6811434, COPI-dependent Golgi-to-ER retrograde traffic
R-HSA-68877, Mitotic Prometaphase
R-HSA-9648025, EML4 and NUDC in mitotic spindle formation
R-HSA-983189, Kinesins
SIGNORiQ99661

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		11004, 164 hits in 887 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		KIF2C, human
EvolutionaryTraceiQ99661

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		KIF2C

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		11004
PharosiQ99661, Tbio

Protein Ontology

More...PROi		PR:Q99661
RNActiQ99661, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000142945, Expressed in testis and 159 other tissues
ExpressionAtlasiQ99661, baseline and differential
GenevisibleiQ99661, HS

Family and domain databases

Gene3Di3.40.850.10, 1 hit
InterProiView protein in InterPro
IPR027640, Kinesin-like_fam
IPR019821, Kinesin_motor_CS
IPR001752, Kinesin_motor_dom
IPR036961, Kinesin_motor_dom_sf
IPR027417, P-loop_NTPase
PANTHERiPTHR24115, PTHR24115, 1 hit
PfamiView protein in Pfam
PF00225, Kinesin, 1 hit
PRINTSiPR00380, KINESINHEAVY
SMARTiView protein in SMART
SM00129, KISc, 1 hit
SUPFAMiSSF52540, SSF52540, 1 hit
PROSITEiView protein in PROSITE
PS00411, KINESIN_MOTOR_1, 1 hit
PS50067, KINESIN_MOTOR_2, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiKIF2C_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q99661
Secondary accession number(s): B3ITR9
, Q5JR88, Q6ICU1, Q96C18, Q96HB8, Q9BWV8
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: January 11, 2001
Last sequence update: January 23, 2002
Last modified: February 10, 2021
This is version 207 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. Human entries with genetic variants
    List of human entries with genetic variants
  3. Human variants curated from literature reports
    Index of human variants curated from literature reports
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again