Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 176 (10 Apr 2019)
Sequence version 2 (01 Jun 2001)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

TSC22 domain family protein 3

Gene

TSC22D3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Protects T-cells from IL2 deprivation-induced apoptosis through the inhibition of FOXO3A transcriptional activity that leads to the down-regulation of the pro-apoptotic factor BCL2L11. In macrophages, plays a role in the anti-inflammatory and immunosuppressive effects of glucocorticoids and IL10. In T-cells, inhibits anti-CD3-induced NFKB1 nuclear translocation. In vitro, suppresses AP1 and NFKB1 DNA-binding activities (By similarity). Isoform 1 inhibits myogenic differentiation and mediates anti-myogenic effects of glucocorticoids by binding and regulating MYOD1 and HDAC1 transcriptional activity resulting in reduced expression of MYOG (By similarity).By similarity1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-2672351 Stimuli-sensing channels

SIGNOR Signaling Network Open Resource

More...
SIGNORi
Q99576

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
TSC22 domain family protein 3
Alternative name(s):
DSIP-immunoreactive peptide
Short name:
Protein DIP
Short name:
hDIP
Delta sleep-inducing peptide immunoreactor
Glucocorticoid-induced leucine zipper protein
Short name:
GILZ
TSC-22-like protein
TSC-22-related protein
Short name:
TSC-22R
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:TSC22D3
Synonyms:DSIPI, GILZ
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome X

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000157514.16

Human Gene Nomenclature Database

More...
HGNCi
HGNC:3051 TSC22D3

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
300506 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q99576

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Cytoplasm, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
1831

Open Targets

More...
OpenTargetsi
ENSG00000157514

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA27504

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
TSC22D3

Domain mapping of disease mutations (DMDM)

More...
DMDMi
14195584

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002193701 – 134TSC22 domain family protein 3Add BLAST134

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei102PhosphoserineCombined sources1
Isoform 2 (identifier: Q99576-3)
Modified residuei42PhosphoserineCombined sources1
Modified residuei73PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q99576

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q99576

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q99576

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q99576

PeptideAtlas

More...
PeptideAtlasi
Q99576

PRoteomics IDEntifications database

More...
PRIDEi
Q99576

ProteomicsDB human proteome resource

More...
ProteomicsDBi
78335
78336 [Q99576-3]
78337 [Q99576-4]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q99576

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q99576

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in brain, lung, spleen and skeletal muscle. Lower levels detected in heart and kidney. Not detected in the pancreas. In non-lymphoid tissues, in the absence of inflammation, the major source of constitutive expression is the macrophage lineage. Also expressed in cells from different hemopoietic cell lineages, including bone marrow cells, CD34+ stem cells, mature B- and T-cells, monocytes and granulocytes. Down-regulated in activated macrophages from inflammatory lesions of delayed-type hypersensitivity (DTH) reactions, such as in tuberculosis and in Crohn disease, whereas in Burkitt lymphoma, persists in macrophages involved in the phagocytosis of apoptotic malignant cells.2 Publications

<p>This subsection of the ‘Expression’ section reports the experimentally proven effects of inducers and repressors (usually chemical compounds or environmental factors) on the level of protein (or mRNA) expression (up-regulation, down-regulation, constitutive expression).<p><a href='/help/induction' target='_top'>More...</a></p>Inductioni

By glucocorticoids in lymphoid cells and upon IL4, IL10, IL13 or glucocorticoid treatment in monocyte/macrophage cells. Transiently induced by IL2 deprivation in T-cells. Isoform 1 expression is up-regulated by synthetic glucocorticoid dexamethasone in differentiating myoblasts (By similarity).By similarity

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000157514 Expressed in 236 organ(s), highest expression level in right lung

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q99576 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q99576 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
CAB034364
HPA001916

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Can form homodimers, however it is likely to function as a monomer. Interacts with AP1 (By similarity). Interacts with NFKB1. Isoform 1 interacts with MYOD1 (By similarity). Isoform 1 interacts with HDAC1; this interaction affects HDAC1 activity on MYOG promoter and thus inhibits MYOD1 transcriptional activity (By similarity).By similarity

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
108165, 48 interactors

Protein interaction database and analysis system

More...
IntActi
Q99576, 12 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000361458

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
Q99576

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q99576

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni1 – 60AP1-bindingBy similarityAdd BLAST60
Regioni76 – 97Leucine-zipperAdd BLAST22

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The leucine-zipper is involved in homodimerization.By similarity

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the TSC-22/Dip/Bun family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IRR1 Eukaryota
ENOG410YAFT LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000156656

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG075918

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q99576

Identification of Orthologs from Complete Genome Data

More...
OMAi
STEMFAK

Database of Orthologous Groups

More...
OrthoDBi
1602203at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q99576

TreeFam database of animal gene trees

More...
TreeFami
TF329224

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR000580 TSC-22_Dip_Bun

The PANTHER Classification System

More...
PANTHERi
PTHR12348 PTHR12348, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF01166 TSC22, 1 hit

ProDom; a protein domain database

More...
ProDomi
View protein in ProDom or Entries sharing at least one domain
PD007152 TSC-22_Dip_Bun, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS01289 TSC22, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 12 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q99576-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MNTEMYQTPM EVAVYQLHNF SISFFSSLLG GDVVSVKLDN SASGASVVAI
60 70 80 90 100
DNKIEQAMDL VKNHLMYAVR EEVEILKEQI RELVEKNSQL ERENTLLKTL
110 120 130
ASPEQLEKFQ SCLSPEEPAP ESPQVPEAPG GSAV
Length:134
Mass (Da):14,810
Last modified:June 1, 2001 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i77B1024969FA8687
GO
Isoform 2 (identifier: Q99576-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-40: MNTEMYQTPM...GDVVSVKLDN → MAQSKLDCRS...TMLSILLFFH

Show »
Length:200
Mass (Da):22,213
Checksum:i5CBFE801E1700C8C
GO
Isoform 3 (identifier: Q99576-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-41: MNTEMYQTPMEVAVYQLHNFSISFFSSLLGGDVVSVKLDNS → GGWPSAVRAWEKAGSLPAEKEFLASFRAG

Note: Incomplete sequence. No experimental confirmation available.
Show »
Length:122
Mass (Da):13,286
Checksum:i3FA577D9052EDB7C
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 12 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
Q5JRJ2Q5JRJ2_HUMAN
TSC22 domain family protein 3
TSC22D3
77Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
Q5JRJ0Q5JRJ0_HUMAN
TSC22 domain family protein 3
TSC22D3
110Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E7EWD5E7EWD5_HUMAN
TSC22 domain family protein 3
TSC22D3
132Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D6RCK9D6RCK9_HUMAN
TSC22 domain family protein 3
TSC22D3
124Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D6R8Z7D6R8Z7_HUMAN
TSC22 domain family protein 3
TSC22D3
58Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D6RAX8D6RAX8_HUMAN
TSC22 domain family protein 3
TSC22D3
116Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D6RD37D6RD37_HUMAN
TSC22 domain family protein 3
TSC22D3
100Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D6RBL1D6RBL1_HUMAN
TSC22 domain family protein 3
TSC22D3
119Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D6RD92D6RD92_HUMAN
TSC22 domain family protein 3
TSC22D3
25Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D6RDZ7D6RDZ7_HUMAN
TSC22 domain family protein 3
TSC22D3
84Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
There are more potential isoformsShow all

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAH18148 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence CAA90644 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence CAB53669 differs from that shown. Reason: Frameshift at position 4.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti54I → F in CAA90644 (PubMed:8982256).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0207321 – 41MNTEM…KLDNS → GGWPSAVRAWEKAGSLPAEK EFLASFRAG in isoform 3. 2 PublicationsAdd BLAST41
Alternative sequenceiVSP_0126891 – 40MNTEM…VKLDN → MAQSKLDCRSPVGLDCCNCC LDLAHRSGLQRGSSGENNNP GSPTVSNFRQLQEKLVFENL NTDKLNSIMRQDSLEPVLRD PCYLINEGICNRNIDQTMLS ILLFFH in isoform 2. 1 PublicationAdd BLAST40

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
Z50781 mRNA Translation: CAA90644.1 Different initiation.
AF228339 mRNA Translation: AAG12456.1
AF183393 mRNA Translation: AAD56234.1
AB025432 mRNA Translation: BAB18680.1
AF153603 mRNA Translation: AAD41085.1
AL110191 mRNA Translation: CAB53669.1 Frameshift.
AK092645 mRNA Translation: BAC03934.1
AK092669 mRNA Translation: BAG52587.1
AL590423 Genomic DNA No translation available.
CH471120 Genomic DNA Translation: EAX02704.1
CH471120 Genomic DNA Translation: EAX02705.1
CH471120 Genomic DNA Translation: EAX02706.1
CR933650 mRNA Translation: CAI45951.1
BC018148 mRNA Translation: AAH18148.3 Different initiation.
BC072446 mRNA Translation: AAH72446.1
CR533450 mRNA Translation: CAG38481.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS14530.1 [Q99576-3]
CCDS14531.1 [Q99576-1]

Protein sequence database of the Protein Information Resource

More...
PIRi
T14749

NCBI Reference Sequences

More...
RefSeqi
NP_001015881.1, NM_001015881.1
NP_001305397.1, NM_001318468.1 [Q99576-3]
NP_001305399.1, NM_001318470.1 [Q99576-3]
NP_004080.2, NM_004089.3 [Q99576-1]
NP_932174.1, NM_198057.2 [Q99576-3]
XP_005262156.1, XM_005262099.1 [Q99576-3]
XP_005262157.1, XM_005262100.1 [Q99576-3]
XP_005262159.1, XM_005262102.1 [Q99576-3]
XP_005262160.1, XM_005262103.3 [Q99576-3]
XP_011529186.1, XM_011530884.1 [Q99576-3]
XP_016884824.1, XM_017029335.1 [Q99576-3]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.522074

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000315660; ENSP00000314655; ENSG00000157514 [Q99576-3]
ENST00000372383; ENSP00000361458; ENSG00000157514 [Q99576-3]
ENST00000372384; ENSP00000361459; ENSG00000157514 [Q99576-3]
ENST00000372397; ENSP00000361474; ENSG00000157514 [Q99576-1]
ENST00000506081; ENSP00000427427; ENSG00000157514 [Q99576-3]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
1831

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:1831

UCSC genome browser

More...
UCSCi
uc004eng.4 human [Q99576-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
Z50781 mRNA Translation: CAA90644.1 Different initiation.
AF228339 mRNA Translation: AAG12456.1
AF183393 mRNA Translation: AAD56234.1
AB025432 mRNA Translation: BAB18680.1
AF153603 mRNA Translation: AAD41085.1
AL110191 mRNA Translation: CAB53669.1 Frameshift.
AK092645 mRNA Translation: BAC03934.1
AK092669 mRNA Translation: BAG52587.1
AL590423 Genomic DNA No translation available.
CH471120 Genomic DNA Translation: EAX02704.1
CH471120 Genomic DNA Translation: EAX02705.1
CH471120 Genomic DNA Translation: EAX02706.1
CR933650 mRNA Translation: CAI45951.1
BC018148 mRNA Translation: AAH18148.3 Different initiation.
BC072446 mRNA Translation: AAH72446.1
CR533450 mRNA Translation: CAG38481.1
CCDSiCCDS14530.1 [Q99576-3]
CCDS14531.1 [Q99576-1]
PIRiT14749
RefSeqiNP_001015881.1, NM_001015881.1
NP_001305397.1, NM_001318468.1 [Q99576-3]
NP_001305399.1, NM_001318470.1 [Q99576-3]
NP_004080.2, NM_004089.3 [Q99576-1]
NP_932174.1, NM_198057.2 [Q99576-3]
XP_005262156.1, XM_005262099.1 [Q99576-3]
XP_005262157.1, XM_005262100.1 [Q99576-3]
XP_005262159.1, XM_005262102.1 [Q99576-3]
XP_005262160.1, XM_005262103.3 [Q99576-3]
XP_011529186.1, XM_011530884.1 [Q99576-3]
XP_016884824.1, XM_017029335.1 [Q99576-3]
UniGeneiHs.522074

3D structure databases

ProteinModelPortaliQ99576
SMRiQ99576
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi108165, 48 interactors
IntActiQ99576, 12 interactors
STRINGi9606.ENSP00000361458

PTM databases

iPTMnetiQ99576
PhosphoSitePlusiQ99576

Polymorphism and mutation databases

BioMutaiTSC22D3
DMDMi14195584

Proteomic databases

EPDiQ99576
jPOSTiQ99576
MaxQBiQ99576
PaxDbiQ99576
PeptideAtlasiQ99576
PRIDEiQ99576
ProteomicsDBi78335
78336 [Q99576-3]
78337 [Q99576-4]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
1831
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000315660; ENSP00000314655; ENSG00000157514 [Q99576-3]
ENST00000372383; ENSP00000361458; ENSG00000157514 [Q99576-3]
ENST00000372384; ENSP00000361459; ENSG00000157514 [Q99576-3]
ENST00000372397; ENSP00000361474; ENSG00000157514 [Q99576-1]
ENST00000506081; ENSP00000427427; ENSG00000157514 [Q99576-3]
GeneIDi1831
KEGGihsa:1831
UCSCiuc004eng.4 human [Q99576-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
1831
DisGeNETi1831
EuPathDBiHostDB:ENSG00000157514.16

GeneCards: human genes, protein and diseases

More...
GeneCardsi
TSC22D3
HGNCiHGNC:3051 TSC22D3
HPAiCAB034364
HPA001916
MIMi300506 gene
neXtProtiNX_Q99576
OpenTargetsiENSG00000157514
PharmGKBiPA27504

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG410IRR1 Eukaryota
ENOG410YAFT LUCA
GeneTreeiENSGT00940000156656
HOVERGENiHBG075918
InParanoidiQ99576
OMAiSTEMFAK
OrthoDBi1602203at2759
PhylomeDBiQ99576
TreeFamiTF329224

Enzyme and pathway databases

ReactomeiR-HSA-2672351 Stimuli-sensing channels
SIGNORiQ99576

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
TSC22D3 human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
TSC22D3

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
1831

Protein Ontology

More...
PROi
PR:Q99576

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000157514 Expressed in 236 organ(s), highest expression level in right lung
ExpressionAtlasiQ99576 baseline and differential
GenevisibleiQ99576 HS

Family and domain databases

InterProiView protein in InterPro
IPR000580 TSC-22_Dip_Bun
PANTHERiPTHR12348 PTHR12348, 1 hit
PfamiView protein in Pfam
PF01166 TSC22, 1 hit
ProDomiView protein in ProDom or Entries sharing at least one domain
PD007152 TSC-22_Dip_Bun, 1 hit
PROSITEiView protein in PROSITE
PS01289 TSC22, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiT22D3_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q99576
Secondary accession number(s): Q5H9S3
, Q5JRI9, Q6FIH6, Q8NAI1, Q8WVB9, Q9UBN5, Q9UG13
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: June 1, 2001
Last modified: April 10, 2019
This is version 176 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome X
    Human chromosome X: entries, gene names and cross-references to MIM
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again