UniProtKB - Q99574 (NEUS_HUMAN)

BLAST

>sp|Q99574|NEUS_HUMAN Neuroserpin OS=Homo sapiens OX=9606 GN=SERPINI1 PE=1 SV=1
MAFLGLFSLLVLQSMATGATFPEEAIADLSVNMYNRLRATGEDENILFSPLSIALAMGMM
ELGAQGSTQKEIRHSMGYDSLKNGEEFSFLKEFSNMVTAKESQYVMKIANSLFVQNGFHV
NEEFLQMMKKYFNAAVNHVDFSQNVAVANYINKWVENNTNNLVKDLVSPRDFDAATYLAL
INAVYFKGNWKSQFRPENTRTFSFTKDDESEVQIPMMYQQGEFYYGEFSDGSNEAGGIYQ
VLEIPYEGDEISMMLVLSRQEVPLATLEPLVKAQLVEEWANSVKKQKVEVYLPRFTVEQE
IDLKDVLKALGITEIFIKDANLTGLSDNKEIFLSKAIHKSFLEVNEEGSEAAAVSGMIAI
SRMAVLYPQVIVDHPFFFLIRNRRTGTILFMGRVMHPETMNTSGHDFEEL

Align
Format
Add to basket Added to basket
History
Entry version 163 (07 Nov 2018)
Sequence version 1 (01 May 1997)
Previous versions | rss
Other tutorials and videos
Help video
Feedback

Protein

Neuroserpin

Gene

SERPINI1

Organism

Homo sapiens (Human)

Status

Reviewed-Annotation score: -Experimental evidence at protein levelⁱ

Functionⁱ

Serine protease inhibitor that inhibits plasminogen activators and plasmin but not thrombin (PubMed:9442076, PubMed:26329378, PubMed:19265707, PubMed:19285087, PubMed:11880376). May be involved in the formation or reorganization of synaptic connections as well as for synaptic plasticity in the adult nervous system. May protect neurons from cell damage by tissue-type plasminogen activator (Probable).Curated5 Publications

Sites

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Siteⁱ	362 – 363	Reactive bond1 Publication1 Publication		2

GO - Molecular functionⁱ

serine-type endopeptidase inhibitor activity
Source: UniProtKB
Inferred from direct assayⁱ
- 19285087
- 9442076

View the complete GO annotation on QuickGO ...

GO - Biological processⁱ

central nervous system development
Source: ProtInc
Traceable author statementⁱ
- 9070919
negative regulation of endopeptidase activity
Source: GO_Central
Inferred from biological aspect of ancestorⁱ
- 21873635
peripheral nervous system development
Source: ProtInc
Traceable author statementⁱ
- 9070919
positive regulation of neuron projection development Source: ARUK-UCL
regulation of cell adhesion Source: Ensembl

View the complete GO annotation on QuickGO ...

Keywordsⁱ

Molecular function	Protease inhibitor, Serine protease inhibitor

Molecular function

Protease inhibitor, Serine protease inhibitor

Protein family/group databases

MEROPS protease database More...MEROPSⁱ	I04.025

MEROPSⁱ

I04.025

Names & Taxonomyⁱ

Protein namesⁱ	Recommended name: Neuroserpin Alternative name(s): Peptidase inhibitor 12 Short name: PI-12 Serpin I1
Gene namesⁱ	Name:SERPINI1 Synonyms:PI12
Organismⁱ	Homo sapiens (Human)
Taxonomic identifierⁱ	9606 [NCBI]
Taxonomic lineageⁱ	cellular organisms › Eukaryota › Opisthokonta › Metazoa › Eumetazoa › Bilateria › Deuterostomia › Chordata › Craniata › Vertebrata › Gnathostomata › Teleostomi › Euteleostomi › Sarcopterygii › Dipnotetrapodomorpha › Tetrapoda › Amniota › Mammalia › Theria › Eutheria › Boreoeutheria › Euarchontoglires › Primates › Haplorrhini › Simiiformes › Catarrhini › Hominoidea › Hominidae › Homininae › Homo
Proteomesⁱ	UP000005640 Componentⁱ: Chromosome 3

Organism-specific databases

EuPathDBⁱ	HostDB:ENSG00000163536.12
Human Gene Nomenclature Database More...HGNCⁱ	HGNC:8943 SERPINI1
MIMⁱ	602445 gene
neXtProtⁱ	NX_Q99574

Keywords - Cellular componentⁱ

Cytoplasmic vesicle, Secreted

Pathology & Biotechⁱ

Involvement in diseaseⁱ

Encephalopathy, familial, with neuroserpin inclusion bodies (FENIB)2 Publications

The disease is caused by mutations affecting the gene represented in this entry.

Disease descriptionA neurodegenerative disease clinically characterized by dementia. Additional features include intellectual decline, psychic seizures, progressive myoclonic epilepsy, and cerebral atrophy. Histologically, it is characterized by the presence of eosinophilic inclusion bodies (called Collins bodies) throughout the deeper layers of the cerebral cortex, leading to neuronal death.

Mutagenesis

Feature key	Position(s)	DescriptionActions	Length
Mutagenesisⁱ	161	N → G: Increases protein stability and abolishes tendency to form polymers. No effect on inhibitory activity. 1 Publication	1
Mutagenesisⁱ	162	L → K: Increases protein stability and abolishes tendency to form polymers. No effect on inhibitory activity. 1 Publication	1
Mutagenesisⁱ	163	V → I: Increases protein stability and decreases tendency to form polymers. No effect on inhibitory activity. 1 Publication	1
Mutagenesisⁱ	289	E → A: Slightly decreases inhibitory activity. No effect on thermal stability. 1 Publication	1
Mutagenesisⁱ	340	S → A: Increases protein stability and decreases tendency to form polymers. No effect on inhibitory activity. 1 Publication	1

Keywords - Diseaseⁱ

Disease mutation, Neurodegeneration

Organism-specific databases

DisGeNET More...DisGeNETⁱ	5274
MalaCards human disease database More...MalaCardsⁱ	SERPINI1
MIMⁱ	604218 phenotype
Open Targets More...OpenTargetsⁱ	ENSG00000163536
Orphanetⁱ	85110 Familial encephalopathy with neuroserpin inclusion bodies
PharmGKBⁱ	PA35511

Polymorphism and mutation databases

BioMutaⁱ	SERPINI1
DMDMⁱ	3183087

PTM / Processingⁱ

Molecule processing

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Signal peptideⁱ	1 – 16	Sequence analysisAdd BLAST		16
ChainⁱPRO_0000032521	17 – 410	NeuroserpinAdd BLAST		394

Amino acid modifications

Feature key	Position(s)	DescriptionActions	Length
Glycosylationⁱ	157	N-linked (GlcNAc...) asparagineSequence analysis	1
Glycosylationⁱ	321	N-linked (GlcNAc...) asparagineSequence analysis	1
Glycosylationⁱ	401	N-linked (GlcNAc...) asparagineSequence analysis	1

Keywords - PTMⁱ

Glycoprotein

Proteomic databases

EPDⁱ	Q99574
MaxQB - The MaxQuant DataBase More...MaxQBⁱ	Q99574
PaxDbⁱ	Q99574
PeptideAtlas More...PeptideAtlasⁱ	Q99574
PRIDEⁱ	Q99574
ProteomicsDBⁱ	78333

PTM databases

GlyConnectⁱ	1559
iPTMnetⁱ	Q99574
PhosphoSitePlusⁱ	Q99574

Miscellaneous databases

PMAP-CutDBⁱ	Q99574

PMAP-CutDBⁱ

Q99574

Expressionⁱ

Tissue specificityⁱ

Gene expression databases

Bgeeⁱ	ENSG00000163536 Expressed in 230 organ(s), highest expression level in substantia nigra
CleanExⁱ	HS_SERPINI1
ExpressionAtlasⁱ	Q99574 baseline and differential
Genevisibleⁱ	Q99574 HS

Organism-specific databases

Human Protein Atlas More...HPAⁱ	CAB026059 HPA001565 HPA056092

HPAⁱ

CAB026059
HPA001565
HPA056092

Interactionⁱ

Subunit structureⁱ

Monomer. Has a tendency to form large polymers already at 41 and 45 degrees Celsius (in vitro).2 Publications

Protein-protein interaction databases

BioGridⁱ	111292, 3 interactors
IntActⁱ	Q99574, 1 interactor
STRINGⁱ	9606.ENSP00000295777

Structureⁱ

Secondary structure

Legend: HelixTurnBeta strandPDB Structure known for this area

Feature key	Position(s)	DescriptionActions	Length
Helixⁱ	25 – 40	Combined sources	16
Beta strandⁱ	46 – 48	Combined sources	3
Helixⁱ	50 – 63	Combined sources	14
Helixⁱ	66 – 76	Combined sources	11
Helixⁱ	86 – 91	Combined sources	6
Turnⁱ	101 – 103	Combined sources	3
Beta strandⁱ	105 – 115	Combined sources	11
Helixⁱ	122 – 132	Combined sources	11
Beta strandⁱ	135 – 139	Combined sources	5
Helixⁱ	144 – 157	Combined sources	14
Turnⁱ	158 – 161	Combined sources	4
Helixⁱ	169 – 171	Combined sources	3
Beta strandⁱ	176 – 192	Combined sources	17
Helixⁱ	196 – 198	Combined sources	3
Beta strandⁱ	200 – 205	Combined sources	6
Beta strandⁱ	211 – 229	Combined sources	19
Beta strandⁱ	238 – 246	Combined sources	9
Beta strandⁱ	249 – 257	Combined sources	9
Helixⁱ	264 – 267	Combined sources	4
Helixⁱ	268 – 270	Combined sources	3
Helixⁱ	273 – 282	Combined sources	10
Beta strandⁱ	284 – 293	Combined sources	10
Beta strandⁱ	295 – 302	Combined sources	8
Helixⁱ	303 – 310	Combined sources	8
Helixⁱ	314 – 316	Combined sources	3
Turnⁱ	323 – 325	Combined sources	3
Beta strandⁱ	331 – 344	Combined sources	14
Beta strandⁱ	346 – 361	Combined sources	16
Beta strandⁱ	369 – 371	Combined sources	3
Beta strandⁱ	376 – 382	Combined sources	7
Turnⁱ	383 – 385	Combined sources	3
Beta strandⁱ	388 – 395	Combined sources	8

Show more details

3D structure databases

ProteinModelPortalⁱ	Q99574
SMRⁱ	Q99574
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Miscellaneous databases

EvolutionaryTraceⁱ	Q99574

EvolutionaryTraceⁱ

Q99574

Family & Domainsⁱ

Sequence similaritiesⁱ

Belongs to the serpin family.Curated

Keywords - Domainⁱ

Signal

Phylogenomic databases

eggNOGⁱ	KOG2392 Eukaryota COG4826 LUCA
Ensembl GeneTree More...GeneTreeⁱ	ENSGT00930000150820
HOGENOMⁱ	HOG000238519
HOVERGENⁱ	HBG005957
InParanoidⁱ	Q99574
OMAⁱ	KDFSNMV
Database of Orthologous Groups More...OrthoDBⁱ	EOG091G0ION
PhylomeDBⁱ	Q99574
TreeFamⁱ	TF352620

Family and domain databases

InterProⁱ	View protein in InterPro IPR023795 Serpin_CS IPR023796 Serpin_dom IPR000215 Serpin_fam IPR036186 Serpin_sf
PANTHERⁱ	PTHR11461 PTHR11461, 1 hit
Pfam protein domain database More...Pfamⁱ	View protein in Pfam PF00079 Serpin, 1 hit
SMARTⁱ	View protein in SMART SM00093 SERPIN, 1 hit
SUPFAMⁱ	SSF56574 SSF56574, 1 hit
PROSITEⁱ	View protein in PROSITE PS00284 SERPIN, 1 hit

Sequence (1+)ⁱ

Sequence statusⁱ: Complete.

Sequence processingⁱ: The displayed sequence is further processed into a mature form.

This entry has 1 described isoform and 3 potential isoforms that are computationally mapped.Show all Align All

Q99574-1 [UniParc]FASTA Add to basket

« Hide

        10         20         30         40         50
MAFLGLFSLL VLQSMATGAT FPEEAIADLS VNMYNRLRAT GEDENILFSP 
        60         70         80         90        100
LSIALAMGMM ELGAQGSTQK EIRHSMGYDS LKNGEEFSFL KEFSNMVTAK 
       110        120        130        140        150
ESQYVMKIAN SLFVQNGFHV NEEFLQMMKK YFNAAVNHVD FSQNVAVANY 
       160        170        180        190        200
INKWVENNTN NLVKDLVSPR DFDAATYLAL INAVYFKGNW KSQFRPENTR 
       210        220        230        240        250
TFSFTKDDES EVQIPMMYQQ GEFYYGEFSD GSNEAGGIYQ VLEIPYEGDE 
       260        270        280        290        300
ISMMLVLSRQ EVPLATLEPL VKAQLVEEWA NSVKKQKVEV YLPRFTVEQE 
       310        320        330        340        350
IDLKDVLKAL GITEIFIKDA NLTGLSDNKE IFLSKAIHKS FLEVNEEGSE 
       360        370        380        390        400
AAAVSGMIAI SRMAVLYPQV IVDHPFFFLI RNRRTGTILF MGRVMHPETM 
       410
NTSGHDFEEL

Length:410

Mass (Da):46,427

Last modified:May 1, 1997 - v1

Checksum:ⁱD966E9036BB21943

Computationally mapped potential isoform sequencesⁱ

There are 3 potential isoforms mapped to this entry.BLAST Align Show all Add to basket

Entry	Entry name	Protein names	Gene names	Length	Annotation

C9JDY5	C9JDY5_HUMAN	Neuroserpin Neuroserpin	SERPINI1	245	Annotation score:
C9JQU8	C9JQU8_HUMAN	Neuroserpin Neuroserpin	SERPINI1	160	Annotation score:
H7C5T9	H7C5T9_HUMAN	Neuroserpin Neuroserpin	SERPINI1	119	Annotation score:

Experimental Info

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Sequence conflictⁱ	70	K → E in AAH18043 (PubMed:15489334).Curated		1
Sequence conflictⁱ	326	S → Y in AAH18043 (PubMed:15489334).Curated		1

Natural variant

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Natural variantⁱVAR_008520	49	S → P in FENIB; Syracuse; decreased protein stability; decreased proteinase inhibitor activity; increased tendency to form polymers. 2 PublicationsCorresponds to variant dbSNP:rs121909051EnsemblClinVar.		1
Natural variantⁱVAR_008521	52	S → R in FENIB; Portland. 1 Publication		1

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	Z81326 mRNA Translation: CAB03626.1 AF248246, AF248244, AF248245 Genomic DNA Translation: AAG01089.1 AK290082 mRNA Translation: BAF82771.1 CR627434 mRNA Translation: CAH10520.1 CH471052 Genomic DNA Translation: EAW78571.1 CH471052 Genomic DNA Translation: EAW78572.1 CH471052 Genomic DNA Translation: EAW78573.1 BC018043 mRNA Translation: AAH18043.1
The Consensus CDS (CCDS) project More...CCDSⁱ	CCDS3203.1
NCBI Reference Sequences More...RefSeqⁱ	NP_001116224.1, NM_001122752.1 NP_005016.1, NM_005025.4 XP_016862107.1, XM_017006618.1
UniGeneⁱ	Hs.478153

Genome annotation databases

Ensemblⁱ	ENST00000295777; ENSP00000295777; ENSG00000163536 ENST00000446050; ENSP00000397373; ENSG00000163536
GeneIDⁱ	5274
KEGGⁱ	hsa:5274
UCSC genome browser More...UCSCⁱ	uc003ffa.5 human

Similar proteinsⁱ

100% Identity
90% Identity
50% Identity

Protein	Similar proteins		Species	Score	Length	Source
Q99574	Serpin peptidase inhibitor clade I member 1 isoform 1 (Fragment)		HUMAN		410	UniRef100_Q99574
Neuroserpin (Fragment)		HUMAN		245
Neuroserpin (Fragment)		HUMAN		160

Protein	Similar proteins		Species	Score	Length	Source
Q99574	Serpin peptidase inhibitor clade I member 1 isoform 1 (Fragment)		HUMAN		410	UniRef90_Q99574
Serpin family I member 1		LOXAF		412
Uncharacterized protein		SHEEP		411
Uncharacterized protein		AOTNA		410
Neuroserpin		CALJA		410
+81

Protein	Similar proteins		Species	Score	Length	Source
Q99574	Neuroserpin		CHICK		410	UniRef50_Q99574
Serpin peptidase inhibitor clade I member 1 isoform 1 (Fragment)		HUMAN		410
Serpin family I member 1		LOXAF		412
Uncharacterized protein		SHEEP		411
Uncharacterized protein		PANPA		410
+229

Cross-referencesⁱ

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	Z81326 mRNA Translation: CAB03626.1 AF248246, AF248244, AF248245 Genomic DNA Translation: AAG01089.1 AK290082 mRNA Translation: BAF82771.1 CR627434 mRNA Translation: CAH10520.1 CH471052 Genomic DNA Translation: EAW78571.1 CH471052 Genomic DNA Translation: EAW78572.1 CH471052 Genomic DNA Translation: EAW78573.1 BC018043 mRNA Translation: AAH18043.1
CCDSⁱ	CCDS3203.1
RefSeqⁱ	NP_001116224.1, NM_001122752.1 NP_005016.1, NM_005025.4 XP_016862107.1, XM_017006618.1
UniGeneⁱ	Hs.478153

3D structure databases

Select the link destinations: Protein Data Bank Europe More...PDBeⁱ Protein Data Bank RCSB More...RCSB PDBⁱ Protein Data Bank Japan More...PDBjⁱ Links Updated	PDB entry	Method	Resolution (Å)	Chain	Positions	PDBsum
	3F02	X-ray	1.80	A/B	17-362	[»]
				C/D	363-410	[»]
	3F5N	X-ray	3.15	A/B/C/D/E	17-410	[»]
	3FGQ	X-ray	2.09	A/B	17-400	[»]
ProteinModelPortalⁱ	Q99574
SMRⁱ	Q99574
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Protein-protein interaction databases

BioGridⁱ	111292, 3 interactors
IntActⁱ	Q99574, 1 interactor
STRINGⁱ	9606.ENSP00000295777

Protein family/group databases

MEROPSⁱ	I04.025

MEROPSⁱ

I04.025

PTM databases

GlyConnectⁱ	1559
iPTMnetⁱ	Q99574
PhosphoSitePlusⁱ	Q99574

Polymorphism and mutation databases

BioMutaⁱ	SERPINI1
DMDMⁱ	3183087

Proteomic databases

EPDⁱ	Q99574
MaxQBⁱ	Q99574
PaxDbⁱ	Q99574
PeptideAtlasⁱ	Q99574
PRIDEⁱ	Q99574
ProteomicsDBⁱ	78333

Protocols and materials databases

The DNASU plasmid repository More...DNASUⁱ	5274
Structural Biology Knowledgebase	Search...

Genome annotation databases

Ensemblⁱ	ENST00000295777; ENSP00000295777; ENSG00000163536 ENST00000446050; ENSP00000397373; ENSG00000163536
GeneIDⁱ	5274
KEGGⁱ	hsa:5274
UCSCⁱ	uc003ffa.5 human

Organism-specific databases

CTDⁱ	5274
DisGeNETⁱ	5274
EuPathDBⁱ	HostDB:ENSG00000163536.12
GeneCardsⁱ	SERPINI1
HGNCⁱ	HGNC:8943 SERPINI1
HPAⁱ	CAB026059 HPA001565 HPA056092
MalaCardsⁱ	SERPINI1
MIMⁱ	602445 gene 604218 phenotype
neXtProtⁱ	NX_Q99574
OpenTargetsⁱ	ENSG00000163536
Orphanetⁱ	85110 Familial encephalopathy with neuroserpin inclusion bodies
PharmGKBⁱ	PA35511
GenAtlas: human gene database More...GenAtlasⁱ	Search...

Phylogenomic databases

eggNOGⁱ	KOG2392 Eukaryota COG4826 LUCA
GeneTreeⁱ	ENSGT00930000150820
HOGENOMⁱ	HOG000238519
HOVERGENⁱ	HBG005957
InParanoidⁱ	Q99574
OMAⁱ	KDFSNMV
OrthoDBⁱ	EOG091G0ION
PhylomeDBⁱ	Q99574
TreeFamⁱ	TF352620

Miscellaneous databases

ChiTaRSⁱ	SERPINI1 human
EvolutionaryTraceⁱ	Q99574
GeneWikiⁱ	SERPINI1
GenomeRNAiⁱ	5274
PMAP-CutDBⁱ	Q99574
Protein Ontology More...PROⁱ	PR:Q99574
SOURCEⁱ	Search...

Gene expression databases

Bgeeⁱ	ENSG00000163536 Expressed in 230 organ(s), highest expression level in substantia nigra
CleanExⁱ	HS_SERPINI1
ExpressionAtlasⁱ	Q99574 baseline and differential
Genevisibleⁱ	Q99574 HS

Family and domain databases

InterProⁱ	View protein in InterPro IPR023795 Serpin_CS IPR023796 Serpin_dom IPR000215 Serpin_fam IPR036186 Serpin_sf
PANTHERⁱ	PTHR11461 PTHR11461, 1 hit
Pfamⁱ	View protein in Pfam PF00079 Serpin, 1 hit
SMARTⁱ	View protein in SMART SM00093 SERPIN, 1 hit
SUPFAMⁱ	SSF56574 SSF56574, 1 hit
PROSITEⁱ	View protein in PROSITE PS00284 SERPIN, 1 hit
ProtoNetⁱ	Search...

Entry informationⁱ

Entry nameⁱ	NEUS_HUMAN
Accessionⁱ	Q99574Primary (citable) accession number: Q99574 Secondary accession number(s): A8K217, D3DNP1, Q6AHZ4
Entry historyⁱ	Integrated into UniProtKB/Swiss-Prot:	July 15, 1998
	Last sequence update:	May 1, 1997
	Last modified:	November 7, 2018
	This is version 163 of the entry and version 1 of the sequence. See complete history.
Entry statusⁱ	Reviewed (UniProtKB/Swiss-Prot)
Annotation program	Chordata Protein Annotation Program
Disclaimer	Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousⁱ

Keywords - Technical termⁱ

3D-structure, Complete proteome, Reference proteome

Documents

SIMILARITY comments
Index of protein domains and families
Human chromosome 3
Human chromosome 3: entries, gene names and cross-references to MIM
Human entries with polymorphisms or disease mutations
List of human entries with polymorphisms or disease mutations
Human polymorphisms and disease mutations
Index of human polymorphisms and disease mutations
MIM cross-references
Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
PDB cross-references
Index of Protein Data Bank (PDB) cross-references

UniProtKB

UniParc

Help

UniRef

Proteomes

Annotation systems

Supporting data

UniProtKB - Q99574 (NEUS_HUMAN)

Your basket is currently empty. i <p>When browsing through different UniProt proteins, you can use the ‘basket’ to save them, so that you can back to find or analyse them later.<p><a href='/help/basket' target='_top'>More...</a></p>

Neuroserpin

SERPINI1

Select a section on the left to see content.

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Sites

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

Protein family/group databases

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

Organism-specific databases

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted

Other locations

Extracellular region or secreted

Other locations

Keywords - Cellular componenti

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Keywords - Diseasei

Organism-specific databases

Polymorphism and mutation databases

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Amino acid modifications

Keywords - PTMi

Proteomic databases

PTM databases

Miscellaneous databases

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Organism-specific databases

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

3D structure databases

Miscellaneous databases

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Keywords - Domaini

Phylogenomic databases

Family and domain databases

Experimental Info

Natural variant

Sequence databases

Genome annotation databases

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

3D structure databases

Protein-protein interaction databases

Protein family/group databases

PTM databases

Polymorphism and mutation databases

Proteomic databases

Protocols and materials databases

Genome annotation databases

Organism-specific databases

Phylogenomic databases

Miscellaneous databases

Gene expression databases

Family and domain databases

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Documents

UniProt is an ELIXIR core data resource

Your basket is currently empty. ⁱ

Functionⁱ

GO - Molecular functionⁱ

GO - Biological processⁱ

Names & Taxonomyⁱ

Subcellular locationⁱ

Keywords - Cellular componentⁱ

Pathology & Biotechⁱ

Keywords - Diseaseⁱ

PTM / Processingⁱ

Keywords - PTMⁱ

Expressionⁱ

Interactionⁱ

Structureⁱ

Family & Domainsⁱ

Sequence similaritiesⁱ

Keywords - Domainⁱ

Cross-referencesⁱ

Entry informationⁱ

Miscellaneousⁱ

Keywords - Technical termⁱ