UniProtKB - Q99572 (P2RX7_HUMAN)
(max 400 entries)x
Your basket is currently empty. i <p>When browsing through different UniProt proteins, you can use the ‘basket’ to save them, so that you can back to find or analyse them later.<p><a href='/help/basket' target='_top'>More...</a></p>
Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)
- BLAST>sp|Q99572|P2RX7_HUMAN P2X purinoceptor 7 OS=Homo sapiens OX=9606 GN=P2RX7 PE=1 SV=4 MPACCSCSDVFQYETNKVTRIQSMNYGTIKWFFHVIIFSYVCFALVSDKLYQRKEPVISS VHTKVKGIAEVKEEIVENGVKKLVHSVFDTADYTFPLQGNSFFVMTNFLKTEGQEQRLCP EYPTRRTLCSSDRGCKKGWMDPQSKGIQTGRCVVYEGNQKTCEVSAWCPIEAVEEAPRPA LLNSAENFTVLIKNNIDFPGHNYTTRNILPGLNITCTFHKTQNPQCPIFRLGDIFRETGD NFSDVAIQGGIMGIEIYWDCNLDRWFHHCRPKYSFRRLDDKTTNVSLYPGYNFRYAKYYK ENNVEKRTLIKVFGIRFDILVFGTGGKFDIIQLVVYIGSTLSYFGLAAVFIDFLIDTYSS NCCRSHIYPWCKCCQPCVVNEYYYRKKCESIVEPKPTLKYVSFVDESHIRMVNQQLLGRS LQDVKGQEVPRPAMDFTDLSRLPLALHDTPPIPGQPEEIQLLRKEATPRSRDSPVWCQCG SCLPSQLPESHRCLEELCCRKKPGACITTSELFRKLVLSRHVLQFLLLYQEPLLALDVDS TNSRLRHCAYRCYATWRFGSQDMADFAILPSCCRWRIRKEFPKSEGQYSGFKSPY
- Align
Protein
P2X purinoceptor 7
Gene
P2RX7
Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:
Annotation score:5 out of 5
<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>Select a section on the left to see content.
<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni
Receptor for ATP that acts as a ligand-gated ion channel. Responsible for ATP-dependent lysis of macrophages through the formation of membrane pores permeable to large molecules. Could function in both fast synaptic transmission and the ATP-mediated lysis of antigen-presenting cells. In the absence of its natural ligand, ATP, functions as a scavenger receptor in the recognition and engulfment of apoptotic cells (PubMed:21821797, PubMed:23303206).3 Publications
<p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
- Ref.11"P2X(7) is a scavenger receptor for apoptotic cells in the absence of its ligand, extracellular ATP."
Gu B.J., Saunders B.M., Petrou S., Wiley J.S.
J. Immunol. 187:2365-2375(2011) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION. - Ref.17"A rare functional haplotype of the P2RX4 and P2RX7 genes leads to loss of innate phagocytosis and confers increased risk of age-related macular degeneration."
Gu B.J., Baird P.N., Vessey K.A., Skarratt K.K., Fletcher E.L., Fuller S.J., Richardson A.J., Guymer R.H., Wiley J.S.
FASEB J. 27:1479-1487(2013) [PubMed] [Europe PMC] [Abstract]Cited for: VARIANTS ALA-76; ARG-150; HIS-155; HIS-270; HIS-276; GLN-307; THR-348; SER-357; ARG-460; ALA-496 AND ASN-568, SUBCELLULAR LOCATION, CHARACTERIZATION OF VARIANT ARG-150, FUNCTION. - Ref.18"Purinergic receptors P2RX4 and P2RX7 in familial multiple sclerosis."
Sadovnick A.D., Gu B.J., Traboulsee A.L., Bernales C.Q., Encarnacion M., Yee I.M., Criscuoli M.G., Huang X., Ou A., Milligan C.J., Petrou S., Wiley J.S., Vilarino-Gueell C.
Hum. Mutat. 38:736-744(2017) [PubMed] [Europe PMC] [Abstract]Cited for: VARIANTS ALA-76; TRP-117; LEU-125; ARG-148; ARG-150; HIS-155; MET-205; HIS-264; HIS-270; HIS-276; HIS-288; GLN-307; THR-348; SER-357; SER-361; VAL-433; ARG-460; ALA-496; GLN-521; ILE-522; VAL-535; GLN-544 AND ASN-568, CHARACTERIZATION OF VARIANTS MET-205 AND SER-361, SUBCELLULAR LOCATION, FUNCTION.
<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni
- ATP binding Source: BHF-UCL <p>Inferred by Curator</p> <p>Used for cases where an annotation is not supported by any evidence but can be reasonably inferred by a curator from other GO annotations for which evidence <br />is available.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#ic">GO evidence code guide</a></p> Inferred by curatori
- extracellularly ATP-gated cation channel activity Source: BHF-UCL <p>Inferred from Direct Assay</p> <p>Used to indicate a direct assay for the function, process or component indicated by the GO term.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#ida">GO evidence code guide</a></p> Inferred from direct assayi
- lipopolysaccharide binding Source: BHF-UCL
- protein homodimerization activity Source: BHF-UCL <p>Non-traceable Author Statement</p> <p>Used for statements in the abstract, introduction or discussion of a paper that cannot be traced back to another publication.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#nas">GO evidence code guide</a></p> Non-traceable author statementi
- purinergic nucleotide receptor activity Source: BHF-UCL <p>Inferred from Direct Assay</p> <p>Used to indicate a direct assay for the function, process or component indicated by the GO term.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#ida">GO evidence code guide</a></p> Inferred from direct assayi
- signaling receptor binding Source: BHF-UCL <p>Inferred from Sequence or Structural Similarity <br />Used for any analysis based on sequence alignment, structure comparison, or evaluation of sequence features such as composition.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#iss">GO evidence code guide</a></p> Inferred from sequence or structural similarityi
<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Biological processi
- activation of MAPK activity Source: Ensembl
- apoptotic signaling pathway Source: BHF-UCL
- bleb assembly Source: UniProtKB <p>Inferred from Direct Assay</p> <p>Used to indicate a direct assay for the function, process or component indicated by the GO term.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#ida">GO evidence code guide</a></p> Inferred from direct assayi
- blood coagulation Source: Reactome
- calcium ion transmembrane transport Source: ARUK-UCL <p>Traceable Author Statement</p> <p>Used for information from review articles where the original experiments are traceable through that article and also for information from text books or dictionaries.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#tas">GO evidence code guide</a></p> Traceable author statementi
- calcium-mediated signaling using extracellular calcium source Source: ARUK-UCL <p>Traceable Author Statement</p> <p>Used for information from review articles where the original experiments are traceable through that article and also for information from text books or dictionaries.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#tas">GO evidence code guide</a></p> Traceable author statementi
- cell morphogenesis Source: Ensembl
- cell surface receptor signaling pathway Source: BHF-UCL
- cell surface receptor signaling pathway involved in cell-cell signaling Source: ARUK-UCL <p>Traceable Author Statement</p> <p>Used for information from review articles where the original experiments are traceable through that article and also for information from text books or dictionaries.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#tas">GO evidence code guide</a></p> Traceable author statementi
- cellular response to ATP Source: ARUK-UCL <p>Traceable Author Statement</p> <p>Used for information from review articles where the original experiments are traceable through that article and also for information from text books or dictionaries.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#tas">GO evidence code guide</a></p> Traceable author statementi
- cellular response to dsRNA Source: Ensembl
- ceramide biosynthetic process Source: Ensembl
- collagen metabolic process Source: Ensembl
- cytolysis Source: Ensembl
- defense response to Gram-positive bacterium Source: Ensembl
- extrinsic apoptotic signaling pathway Source: Ensembl
- homeostasis of number of cells within a tissue Source: Ensembl
- inflammatory response Source: Ensembl
- membrane depolarization Source: BHF-UCL <p>Inferred from Direct Assay</p> <p>Used to indicate a direct assay for the function, process or component indicated by the GO term.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#ida">GO evidence code guide</a></p> Inferred from direct assayi
- membrane protein ectodomain proteolysis Source: Ensembl
- mitochondrion organization Source: Ensembl
- NAD transport Source: Ensembl
- negative regulation of bone resorption Source: BHF-UCL
- negative regulation of cell volume Source: UniProtKB <p>Inferred from Mutant Phenotype</p> <p>Describes annotations that are concluded from looking at variations or changes in a gene product such as mutations or abnormal levels and includes techniques such as knockouts, overexpression, anti-sense experiments and use of specific protein inhibitors.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#imp">GO evidence code guide</a></p> Inferred from mutant phenotypei
- negative regulation of MAPK cascade Source: BHF-UCL
- phagolysosome assembly Source: Ensembl
- phospholipid scrambling Source: UniProtKB <p>Inferred from Direct Assay</p> <p>Used to indicate a direct assay for the function, process or component indicated by the GO term.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#ida">GO evidence code guide</a></p> Inferred from direct assayi
- phospholipid transfer to membrane Source: Ensembl
- phospholipid translocation Source: Ensembl
- pore complex assembly Source: BHF-UCL <p>Inferred from Direct Assay</p> <p>Used to indicate a direct assay for the function, process or component indicated by the GO term.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#ida">GO evidence code guide</a></p> Inferred from direct assayi
- positive regulation of bleb assembly Source: UniProtKB <p>Inferred from Mutant Phenotype</p> <p>Describes annotations that are concluded from looking at variations or changes in a gene product such as mutations or abnormal levels and includes techniques such as knockouts, overexpression, anti-sense experiments and use of specific protein inhibitors.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#imp">GO evidence code guide</a></p> Inferred from mutant phenotypei
- positive regulation of bone mineralization Source: BHF-UCL
- positive regulation of calcium ion transport into cytosol Source: BHF-UCL <p>Inferred from Direct Assay</p> <p>Used to indicate a direct assay for the function, process or component indicated by the GO term.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#ida">GO evidence code guide</a></p> Inferred from direct assayi
- positive regulation of cytolysis Source: BHF-UCL
- positive regulation of cytoskeleton organization Source: BHF-UCL
- positive regulation of gamma-aminobutyric acid secretion Source: Ensembl
- positive regulation of gene expression Source: CACAO <p>Inferred from Mutant Phenotype</p> <p>Describes annotations that are concluded from looking at variations or changes in a gene product such as mutations or abnormal levels and includes techniques such as knockouts, overexpression, anti-sense experiments and use of specific protein inhibitors.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#imp">GO evidence code guide</a></p> Inferred from mutant phenotypei
- positive regulation of glutamate secretion Source: Ensembl
- positive regulation of glycolytic process Source: CACAO <p>Inferred from Mutant Phenotype</p> <p>Describes annotations that are concluded from looking at variations or changes in a gene product such as mutations or abnormal levels and includes techniques such as knockouts, overexpression, anti-sense experiments and use of specific protein inhibitors.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#imp">GO evidence code guide</a></p> Inferred from mutant phenotypei
- positive regulation of interleukin-1 alpha secretion Source: Ensembl
- positive regulation of interleukin-1 beta secretion Source: BHF-UCL <p>Inferred from Direct Assay</p> <p>Used to indicate a direct assay for the function, process or component indicated by the GO term.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#ida">GO evidence code guide</a></p> Inferred from direct assayi
- positive regulation of interleukin-6 production Source: Ensembl
- positive regulation of ion transmembrane transport Source: UniProtKB <p>Inferred from Mutant Phenotype</p> <p>Describes annotations that are concluded from looking at variations or changes in a gene product such as mutations or abnormal levels and includes techniques such as knockouts, overexpression, anti-sense experiments and use of specific protein inhibitors.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#imp">GO evidence code guide</a></p> Inferred from mutant phenotypei
- positive regulation of lymphocyte apoptotic process Source: Ensembl
- positive regulation of mitochondrial depolarization Source: Ensembl
- positive regulation of prostaglandin secretion Source: Ensembl
- positive regulation of T cell mediated cytotoxicity Source: Ensembl
- protein catabolic process Source: Ensembl
- protein complex oligomerization Source: Ensembl
- protein phosphorylation Source: Ensembl
- protein processing Source: Ensembl
- purinergic nucleotide receptor signaling pathway Source: UniProtKB <p>Inferred from Mutant Phenotype</p> <p>Describes annotations that are concluded from looking at variations or changes in a gene product such as mutations or abnormal levels and includes techniques such as knockouts, overexpression, anti-sense experiments and use of specific protein inhibitors.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#imp">GO evidence code guide</a></p> Inferred from mutant phenotypei
- reactive oxygen species metabolic process Source: Ensembl
- regulation of killing of cells of other organism Source: BHF-UCL <p>Non-traceable Author Statement</p> <p>Used for statements in the abstract, introduction or discussion of a paper that cannot be traced back to another publication.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#nas">GO evidence code guide</a></p> Non-traceable author statementi
- regulation of sodium ion transport Source: BHF-UCL <p>Inferred from Sequence or Structural Similarity <br />Used for any analysis based on sequence alignment, structure comparison, or evaluation of sequence features such as composition.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#iss">GO evidence code guide</a></p> Inferred from sequence or structural similarityi
- release of sequestered calcium ion into cytosol Source: Ensembl
- response to ATP Source: BHF-UCL <p>Inferred from Direct Assay</p> <p>Used to indicate a direct assay for the function, process or component indicated by the GO term.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#ida">GO evidence code guide</a></p> Inferred from direct assayi
- response to calcium ion Source: Ensembl
- response to electrical stimulus Source: Ensembl
- response to fluid shear stress Source: Ensembl
- response to ischemia Source: ARUK-UCL <p>Non-traceable Author Statement</p> <p>Used for statements in the abstract, introduction or discussion of a paper that cannot be traced back to another publication.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#nas">GO evidence code guide</a></p> Non-traceable author statementi
- response to lipopolysaccharide Source: Ensembl
- response to mechanical stimulus Source: Ensembl
- response to zinc ion Source: Ensembl
- sensory perception of pain Source: BHF-UCL
- skeletal system morphogenesis Source: Ensembl
- synaptic vesicle exocytosis Source: Ensembl
- T cell homeostasis Source: Ensembl
- T cell proliferation Source: Ensembl
- vesicle budding from membrane Source: Ensembl
<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi
| Molecular function | Ion channel, Ligand-gated ion channel, Receptor |
| Biological process | Ion transport, Transport |
Enzyme and pathway databases
Reactome - a knowledgebase of biological pathways and processes More...Reactomei | R-HSA-139853 Elevation of cytosolic Ca2+ levels R-HSA-418346 Platelet homeostasis R-HSA-844456 The NLRP3 inflammasome |
SignaLink: a signaling pathway resource with multi-layered regulatory networks More...SignaLinki | Q99572 |
SIGNOR Signaling Network Open Resource More...SIGNORi | Q99572 |
Protein family/group databases
Transport Classification Database More...TCDBi | 1.A.7.1.3 the atp-gated p2x receptor cation channel (p2x receptor) family |
<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi
| <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi | Recommended name: P2X purinoceptor 7Short name: P2X7 Alternative name(s): ATP receptor P2Z receptor Purinergic receptor |
| <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi | Name:P2RX7 |
| <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>Organismi | Homo sapiens (Human) |
| <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri | 9606 [NCBI] |
| <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineagei | cellular organisms › Eukaryota › Opisthokonta › Metazoa › Eumetazoa › Bilateria › Deuterostomia › Chordata › Craniata › Vertebrata › Gnathostomata › Teleostomi › Euteleostomi › Sarcopterygii › Dipnotetrapodomorpha › Tetrapoda › Amniota › Mammalia › Theria › Eutheria › Boreoeutheria › Euarchontoglires › Primates › Haplorrhini › Simiiformes › Catarrhini › Hominoidea › Hominidae › Homininae › Homo |
| <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi |
|
Organism-specific databases
Eukaryotic Pathogen Database Resources More...EuPathDBi | HostDB:ENSG00000089041.16 |
Human Gene Nomenclature Database More...HGNCi | HGNC:8537 P2RX7 |
Online Mendelian Inheritance in Man (OMIM) More...MIMi | 602566 gene |
neXtProt; the human protein knowledge platform More...neXtProti | NX_Q99572 |
<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi
Plasma membrane
- Cell membrane 3 Publications
<p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
- Ref.8"Epithelial membrane proteins induce membrane blebbing and interact with the P2X7 receptor C terminus."
Wilson H.L., Wilson S.A., Surprenant A., North R.A.
J. Biol. Chem. 277:34017-34023(2002) [PubMed] [Europe PMC] [Abstract]Cited for: INTERACTION WITH EMP2, SUBCELLULAR LOCATION. - Ref.17"A rare functional haplotype of the P2RX4 and P2RX7 genes leads to loss of innate phagocytosis and confers increased risk of age-related macular degeneration."
Gu B.J., Baird P.N., Vessey K.A., Skarratt K.K., Fletcher E.L., Fuller S.J., Richardson A.J., Guymer R.H., Wiley J.S.
FASEB J. 27:1479-1487(2013) [PubMed] [Europe PMC] [Abstract]Cited for: VARIANTS ALA-76; ARG-150; HIS-155; HIS-270; HIS-276; GLN-307; THR-348; SER-357; ARG-460; ALA-496 AND ASN-568, SUBCELLULAR LOCATION, CHARACTERIZATION OF VARIANT ARG-150, FUNCTION. - Ref.18"Purinergic receptors P2RX4 and P2RX7 in familial multiple sclerosis."
Sadovnick A.D., Gu B.J., Traboulsee A.L., Bernales C.Q., Encarnacion M., Yee I.M., Criscuoli M.G., Huang X., Ou A., Milligan C.J., Petrou S., Wiley J.S., Vilarino-Gueell C.
Hum. Mutat. 38:736-744(2017) [PubMed] [Europe PMC] [Abstract]Cited for: VARIANTS ALA-76; TRP-117; LEU-125; ARG-148; ARG-150; HIS-155; MET-205; HIS-264; HIS-270; HIS-276; HIS-288; GLN-307; THR-348; SER-357; SER-361; VAL-433; ARG-460; ALA-496; GLN-521; ILE-522; VAL-535; GLN-544 AND ASN-568, CHARACTERIZATION OF VARIANTS MET-205 AND SER-361, SUBCELLULAR LOCATION, FUNCTION.
- Cell membrane 3 Publications
Nucleus
- integral component of nuclear inner membrane Source: GO_Central
Plasma Membrane
- external side of plasma membrane Source: Ensembl
- integral component of plasma membrane Source: BHF-UCL <p>Inferred by Curator</p> <p>Used for cases where an annotation is not supported by any evidence but can be reasonably inferred by a curator from other GO annotations for which evidence <br />is available.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#ic">GO evidence code guide</a></p> Inferred by curatori
- plasma membrane Source: UniProtKB <p>Inferred from Direct Assay</p> <p>Used to indicate a direct assay for the function, process or component indicated by the GO term.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#ida">GO evidence code guide</a></p> Inferred from direct assayi
Other locations
- bleb Source: BHF-UCL
- cell-cell junction Source: Ensembl
- cytoplasm Source: BHF-UCL
- membrane Source: BHF-UCL <p>Inferred from Direct Assay</p> <p>Used to indicate a direct assay for the function, process or component indicated by the GO term.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#ida">GO evidence code guide</a></p> Inferred from direct assayi
- neuromuscular junction Source: Ensembl
- neuronal cell body Source: Ensembl
- postsynapse Source: GOC
- presynapse Source: GOC
Topology
| Feature key | Position(s) | DescriptionActions | Graphical view | Length |
|---|---|---|---|---|
| <p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini | 1 – 25 | CytoplasmicSequence analysisAdd BLAST | 25 | |
| <p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei | 26 – 46 | Helical; Name=1Sequence analysisAdd BLAST | 21 | |
| <p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini | 47 – 334 | ExtracellularSequence analysisAdd BLAST | 288 | |
| <p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei | 335 – 355 | Helical; Name=2Sequence analysisAdd BLAST | 21 | |
| <p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini | 356 – 595 | CytoplasmicSequence analysisAdd BLAST | 240 |
<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti
Cell membrane, Membrane<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi
Mutagenesis
| Feature key | Position(s) | DescriptionActions | Graphical view | Length |
|---|---|---|---|---|
| <p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi | 187 | N → A: Alters cell surface expression. 1 Publication <p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
| 1 |
Organism-specific databases
DisGeNET More...DisGeNETi | 5027 |
MalaCards human disease database More...MalaCardsi | P2RX7 |
Open Targets More...OpenTargetsi | ENSG00000089041 |
The Pharmacogenetics and Pharmacogenomics Knowledge Base More...PharmGKBi | PA32866 |
Chemistry databases
ChEMBL database of bioactive drug-like small molecules More...ChEMBLi | CHEMBL4805 |
IUPHAR/BPS Guide to PHARMACOLOGY More...GuidetoPHARMACOLOGYi | 484 |
Polymorphism and mutation databases
BioMuta curated single-nucleotide variation and disease association database More...BioMutai | P2RX7 |
Domain mapping of disease mutations (DMDM) More...DMDMi | 395398617 |
<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi
Molecule processing
| Feature key | Position(s) | DescriptionActions | Graphical view | Length |
|---|---|---|---|---|
| <p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_0000161560 | 1 – 595 | P2X purinoceptor 7Add BLAST | 595 |
Amino acid modifications
| Feature key | Position(s) | DescriptionActions | Graphical view | Length |
|---|---|---|---|---|
| <p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi | 119 ↔ 168 | By similarity | ||
| <p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei | 125 | ADP-ribosylarginineBy similarity | 1 | |
| <p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi | 129 ↔ 152 | By similarity | ||
| <p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei | 133 | ADP-ribosylarginineBy similarity | 1 | |
| <p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi | 135 ↔ 162 | By similarity | ||
| <p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi | 187 | N-linked (GlcNAc...) asparagine1 Publication <p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
| 1 | |
| <p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi | 202 | N-linked (GlcNAc...) asparagine1 Publication <p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
| 1 | |
| <p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi | 213 | N-linked (GlcNAc...) asparagine1 Publication <p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
| 1 | |
| <p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi | 216 ↔ 226 | By similarity | ||
| <p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi | 241 | N-linked (GlcNAc...) asparagine1 Publication <p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
| 1 | |
| <p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi | 260 ↔ 269 | By similarity | ||
| <p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi | 284 | N-linked (GlcNAc...) asparagine1 Publication <p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
| 1 | |
| <p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei | 343 | Phosphotyrosine1 Publication <p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
| 1 | |
| <p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei | 390 | PhosphoserineCombined sources <p>Manually validated information inferred from a combination of experimental and computational evidence.</p> <p><a href="/manual/evidences#ECO:0000244">More...</a></p> Manual assertion inferred from combination of experimental and computational evidencei
| 1 |
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi
Phosphorylation results in its inactivation.1 Publication
<p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
- Ref.7"Proteomic and functional evidence for a P2X7 receptor signalling complex."
Kim M., Jiang L.H., Wilson H.L., North R.A., Surprenant A.
EMBO J. 20:6347-6358(2001) [PubMed] [Europe PMC] [Abstract]Cited for: PHOSPHORYLATION AT TYR-343, INTERACTION WITH LAMA3; ITGB2; ACTB; ACTN4; SVIL; MPP3; HSPA1; HSPCB; HSPA8; PIK230 AND PTPRB.
ADP-ribosylation at Arg-125 is necessary and sufficient to activate P2RX7 and gate the channel.By similarity
Palmitoylation of several cysteines in the C-terminal cytoplasmic tail is required for efficient localization to cell surface.1 Publication
<p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
- Ref.9"Palmitoylation of the P2X7 receptor, an ATP-gated channel, controls its expression and association with lipid rafts."
Gonnord P., Delarasse C., Auger R., Benihoud K., Prigent M., Cuif M.H., Lamaze C., Kanellopoulos J.M.
FASEB J. 23:795-805(2009) [PubMed] [Europe PMC] [Abstract]Cited for: PALMITOYLATION.
<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - PTMi
ADP-ribosylation, Disulfide bond, Glycoprotein, Lipoprotein, Palmitate, PhosphoproteinProteomic databases
PaxDb, a database of protein abundance averages across all three domains of life More...PaxDbi | Q99572 |
PeptideAtlas More...PeptideAtlasi | Q99572 |
PRoteomics IDEntifications database More...PRIDEi | Q99572 |
ProteomicsDB human proteome resource More...ProteomicsDBi | 78332 |
PTM databases
iPTMnet integrated resource for PTMs in systems biology context More...iPTMneti | Q99572 |
Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat. More...PhosphoSitePlusi | Q99572 |
SwissPalm database of S-palmitoylation events More...SwissPalmi | Q99572 |
<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni
<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi
Widely expressed with highest levels in brain and immune tissues.1 Publication
<p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
- Ref.3"Identification and characterization of splice variants of the human P2X7 ATP channel."
Cheewatrakoolpong B., Gilchrest H., Anthes J.C., Greenfeder S.
Biochem. Biophys. Res. Commun. 332:17-27(2005) [PubMed] [Europe PMC] [Abstract]Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS B; C; D; E; F; G AND H), ALTERNATIVE SPLICING, TISSUE SPECIFICITY, VARIANTS HIS-155 AND HIS-270.
Gene expression databases
Bgee dataBase for Gene Expression Evolution More...Bgeei | ENSG00000089041 |
CleanEx database of gene expression profiles More...CleanExi | HS_P2RX7 |
ExpressionAtlas, Differential and Baseline Expression More...ExpressionAtlasi | Q99572 baseline and differential |
Genevisible search portal to normalized and curated expression data from Genevestigator More...Genevisiblei | Q99572 HS |
Organism-specific databases
Human Protein Atlas More...HPAi | HPA034967 HPA034968 HPA042013 HPA044141 |
<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni
<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei
Functional P2XRs are organized as homomeric and heteromeric trimers. Interacts with LAMA3, ITGB2, ACTB, ACTN4, SVIL, MPP3, HSPA1, HSPCB, HSPA8, PIK230 and PTPRB. Interacts (via C-terminus) with EMP2 (PubMed:12107182).2 Publications
<p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
- Ref.7"Proteomic and functional evidence for a P2X7 receptor signalling complex."
Kim M., Jiang L.H., Wilson H.L., North R.A., Surprenant A.
EMBO J. 20:6347-6358(2001) [PubMed] [Europe PMC] [Abstract]Cited for: PHOSPHORYLATION AT TYR-343, INTERACTION WITH LAMA3; ITGB2; ACTB; ACTN4; SVIL; MPP3; HSPA1; HSPCB; HSPA8; PIK230 AND PTPRB. - Ref.8"Epithelial membrane proteins induce membrane blebbing and interact with the P2X7 receptor C terminus."
Wilson H.L., Wilson S.A., Surprenant A., North R.A.
J. Biol. Chem. 277:34017-34023(2002) [PubMed] [Europe PMC] [Abstract]Cited for: INTERACTION WITH EMP2, SUBCELLULAR LOCATION.
<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni
- protein homodimerization activity Source: BHF-UCL <p>Non-traceable Author Statement</p> <p>Used for statements in the abstract, introduction or discussion of a paper that cannot be traced back to another publication.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#nas">GO evidence code guide</a></p> Non-traceable author statementi
- signaling receptor binding Source: BHF-UCL <p>Inferred from Sequence or Structural Similarity <br />Used for any analysis based on sequence alignment, structure comparison, or evaluation of sequence features such as composition.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#iss">GO evidence code guide</a></p> Inferred from sequence or structural similarityi
Protein-protein interaction databases
The Biological General Repository for Interaction Datasets (BioGrid) More...BioGridi | 111066, 5 interactors |
The Eukaryotic Linear Motif resource for Functional Sites in Proteins More...ELMi | Q99572 |
Protein interaction database and analysis system More...IntActi | Q99572, 16 interactors |
STRING: functional protein association networks More...STRINGi | 9606.ENSP00000442349 |
Chemistry databases
BindingDB database of measured binding affinities More...BindingDBi | Q99572 |
<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei
3D structure databases
Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase More...ProteinModelPortali | Q99572 |
SWISS-MODEL Repository - a database of annotated 3D protein structure models More...SMRi | Q99572 |
Database of comparative protein structure models More...ModBasei | Search... |
MobiDB: a database of protein disorder and mobility annotations More...MobiDBi | Search... |
<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi
<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi
Belongs to the P2X receptor family.Curated
<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Domaini
Transmembrane, Transmembrane helixPhylogenomic databases
evolutionary genealogy of genes: Non-supervised Orthologous Groups More...eggNOGi | ENOG410IK4U Eukaryota ENOG4110DDY LUCA |
Ensembl GeneTree More...GeneTreei | ENSGT00390000016028 |
The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms More...HOGENOMi | HOG000232042 |
The HOVERGEN Database of Homologous Vertebrate Genes More...HOVERGENi | HBG053086 |
InParanoid: Eukaryotic Ortholog Groups More...InParanoidi | Q99572 |
KEGG Orthology (KO) More...KOi | K05220 |
Identification of Orthologs from Complete Genome Data More...OMAi | YPGYNFR |
Database of Orthologous Groups More...OrthoDBi | EOG091G0A2U |
TreeFam database of animal gene trees More...TreeFami | TF328633 |
Family and domain databases
Gene3D Structural and Functional Annotation of Protein Families More...Gene3Di | 2.60.490.10, 1 hit |
Integrated resource of protein families, domains and functional sites More...InterProi | View protein in InterPro IPR003050 P2X7_purinoceptor IPR027309 P2X_extracellular_dom_sf IPR001429 P2X_purnocptor |
The PANTHER Classification System More...PANTHERi | PTHR10125 PTHR10125, 1 hit PTHR10125:SF13 PTHR10125:SF13, 1 hit |
Pfam protein domain database More...Pfami | View protein in Pfam PF00864 P2X_receptor, 1 hit |
Protein Motif fingerprint database; a protein domain database More...PRINTSi | PR01314 P2X7RECEPTOR PR01307 P2XRECEPTOR |
TIGRFAMs; a protein family database More...TIGRFAMsi | TIGR00863 P2X, 1 hit |
PROSITE; a protein domain and family database More...PROSITEi | View protein in PROSITE PS01212 P2X_RECEPTOR, 1 hit |
<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (8)i
<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.
This entry describes 8 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basketAdded to basket
Isoform A (identifier: Q99572-1) [UniParc]FASTAAdd to basketAdded to basketShow »
This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
10 20 30 40 50
MPACCSCSDV FQYETNKVTR IQSMNYGTIK WFFHVIIFSY VCFALVSDKL
60 70 80 90 100
YQRKEPVISS VHTKVKGIAE VKEEIVENGV KKLVHSVFDT ADYTFPLQGN
110 120 130 140 150
SFFVMTNFLK TEGQEQRLCP EYPTRRTLCS SDRGCKKGWM DPQSKGIQTG
160 170 180 190 200
RCVVYEGNQK TCEVSAWCPI EAVEEAPRPA LLNSAENFTV LIKNNIDFPG
210 220 230 240 250
HNYTTRNILP GLNITCTFHK TQNPQCPIFR LGDIFRETGD NFSDVAIQGG
260 270 280 290 300
IMGIEIYWDC NLDRWFHHCR PKYSFRRLDD KTTNVSLYPG YNFRYAKYYK
310 320 330 340 350
ENNVEKRTLI KVFGIRFDIL VFGTGGKFDI IQLVVYIGST LSYFGLAAVF
360 370 380 390 400
IDFLIDTYSS NCCRSHIYPW CKCCQPCVVN EYYYRKKCES IVEPKPTLKY
410 420 430 440 450
VSFVDESHIR MVNQQLLGRS LQDVKGQEVP RPAMDFTDLS RLPLALHDTP
460 470 480 490 500
PIPGQPEEIQ LLRKEATPRS RDSPVWCQCG SCLPSQLPES HRCLEELCCR
510 520 530 540 550
KKPGACITTS ELFRKLVLSR HVLQFLLLYQ EPLLALDVDS TNSRLRHCAY
560 570 580 590
RCYATWRFGS QDMADFAILP SCCRWRIRKE FPKSEGQYSG FKSPY
Length:595
Mass (Da):68,585
Last modified:July 11, 2012 - v4
<p>The checksum is a form of redundancy check that is calculated
from the sequence. It is useful for tracking sequence updates.</p>
<p>It should be noted that while, in theory, two different sequences could
have the same checksum value, the likelihood that this would happen
is extremely low.</p>
<p>However UniProtKB may contain entries with identical sequences in case
of multiple genes (paralogs).</p>
<p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64)
using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1.
The algorithm is described in the ISO 3309 standard.
</p>
<p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br />
<strong>Cyclic redundancy and other checksums</strong><br />
<a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p>
Checksum:i584C17EF6D5EC899
Isoform B (identifier: Q99572-2) [UniParc]FASTAAdd to basketAdded to basket
Also known as: Delta-C, cytoplasmic tail deleted
The sequence of this isoform differs from the canonical sequence as follows:
347-364: AAVFIDFLIDTYSSNCCR → VRDSLFHALGKWFGEGSD
365-595: Missing.
10 20 30 40 50
MPACCSCSDV FQYETNKVTR IQSMNYGTIK WFFHVIIFSY VCFALVSDKL
60 70 80 90 100
YQRKEPVISS VHTKVKGIAE VKEEIVENGV KKLVHSVFDT ADYTFPLQGN
110 120 130 140 150
SFFVMTNFLK TEGQEQRLCP EYPTRRTLCS SDRGCKKGWM DPQSKGIQTG
160 170 180 190 200
RCVVYEGNQK TCEVSAWCPI EAVEEAPRPA LLNSAENFTV LIKNNIDFPG
210 220 230 240 250
HNYTTRNILP GLNITCTFHK TQNPQCPIFR LGDIFRETGD NFSDVAIQGG
260 270 280 290 300
IMGIEIYWDC NLDRWFHHCR PKYSFRRLDD KTTNVSLYPG YNFRYAKYYK
310 320 330 340 350
ENNVEKRTLI KVFGIRFDIL VFGTGGKFDI IQLVVYIGST LSYFGLVRDS
360
LFHALGKWFG EGSD
Note: Predominant form in many tissues.
Show »Length:364
Mass (Da):41,792
<p>The checksum is a form of redundancy check that is calculated
from the sequence. It is useful for tracking sequence updates.</p>
<p>It should be noted that while, in theory, two different sequences could
have the same checksum value, the likelihood that this would happen
is extremely low.</p>
<p>However UniProtKB may contain entries with identical sequences in case
of multiple genes (paralogs).</p>
<p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64)
using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1.
The algorithm is described in the ISO 3309 standard.
</p>
<p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br />
<strong>Cyclic redundancy and other checksums</strong><br />
<a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p>
Checksum:i3A9C0F1D110543FC
Isoform C (identifier: Q99572-3) [UniParc]FASTAAdd to basketAdded to basketShow »
The sequence of this isoform differs from the canonical sequence as follows:
122-128: YPTRRTL → EFRPEGV
129-595: Missing.
10 20 30 40 50
MPACCSCSDV FQYETNKVTR IQSMNYGTIK WFFHVIIFSY VCFALVSDKL
60 70 80 90 100
YQRKEPVISS VHTKVKGIAE VKEEIVENGV KKLVHSVFDT ADYTFPLQGN
110 120
SFFVMTNFLK TEGQEQRLCP EEFRPEGV
Length:128
Mass (Da):14,749
<p>The checksum is a form of redundancy check that is calculated
from the sequence. It is useful for tracking sequence updates.</p>
<p>It should be noted that while, in theory, two different sequences could
have the same checksum value, the likelihood that this would happen
is extremely low.</p>
<p>However UniProtKB may contain entries with identical sequences in case
of multiple genes (paralogs).</p>
<p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64)
using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1.
The algorithm is described in the ISO 3309 standard.
</p>
<p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br />
<strong>Cyclic redundancy and other checksums</strong><br />
<a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p>
Checksum:iDBBA1D99D97E108E
Isoform D (identifier: Q99572-4) [UniParc]FASTAAdd to basketAdded to basketShow »
The sequence of this isoform differs from the canonical sequence as follows:
1-7: MPACCSC → MDGPAEQ
8-177: Missing.
10 20 30 40 50
MDGPAEQRPA LLNSAENFTV LIKNNIDFPG HNYTTRNILP GLNITCTFHK
60 70 80 90 100
TQNPQCPIFR LGDIFRETGD NFSDVAIQGG IMGIEIYWDC NLDRWFHHCR
110 120 130 140 150
PKYSFRRLDD KTTNVSLYPG YNFRYAKYYK ENNVEKRTLI KVFGIRFDIL
160 170 180 190 200
VFGTGGKFDI IQLVVYIGST LSYFGLAAVF IDFLIDTYSS NCCRSHIYPW
210 220 230 240 250
CKCCQPCVVN EYYYRKKCES IVEPKPTLKY VSFVDESHIR MVNQQLLGRS
260 270 280 290 300
LQDVKGQEVP RPAMDFTDLS RLPLALHDTP PIPGQPEEIQ LLRKEATPRS
310 320 330 340 350
RDSPVWCQCG SCLPSQLPES HRCLEELCCR KKPGACITTS ELFRKLVLSR
360 370 380 390 400
HVLQFLLLYQ EPLLALDVDS TNSRLRHCAY RCYATWRFGS QDMADFAILP
410 420
SCCRWRIRKE FPKSEGQYSG FKSPY
Length:425
Mass (Da):49,165
<p>The checksum is a form of redundancy check that is calculated
from the sequence. It is useful for tracking sequence updates.</p>
<p>It should be noted that while, in theory, two different sequences could
have the same checksum value, the likelihood that this would happen
is extremely low.</p>
<p>However UniProtKB may contain entries with identical sequences in case
of multiple genes (paralogs).</p>
<p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64)
using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1.
The algorithm is described in the ISO 3309 standard.
</p>
<p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br />
<strong>Cyclic redundancy and other checksums</strong><br />
<a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p>
Checksum:i9245A1363145ABD7
Isoform E (identifier: Q99572-5) [UniParc]FASTAAdd to basketAdded to basketShow »
The sequence of this isoform differs from the canonical sequence as follows:
206-294: Missing.
347-364: AAVFIDFLIDTYSSNCCR → VRDSLFHALGKWFGEGSD
365-595: Missing.
10 20 30 40 50
MPACCSCSDV FQYETNKVTR IQSMNYGTIK WFFHVIIFSY VCFALVSDKL
60 70 80 90 100
YQRKEPVISS VHTKVKGIAE VKEEIVENGV KKLVHSVFDT ADYTFPLQGN
110 120 130 140 150
SFFVMTNFLK TEGQEQRLCP EYPTRRTLCS SDRGCKKGWM DPQSKGIQTG
160 170 180 190 200
RCVVYEGNQK TCEVSAWCPI EAVEEAPRPA LLNSAENFTV LIKNNIDFPG
210 220 230 240 250
HNYTTYAKYY KENNVEKRTL IKVFGIRFDI LVFGTGGKFD IIQLVVYIGS
260 270
TLSYFGLVRD SLFHALGKWF GEGSD
Length:275
Mass (Da):31,294
<p>The checksum is a form of redundancy check that is calculated
from the sequence. It is useful for tracking sequence updates.</p>
<p>It should be noted that while, in theory, two different sequences could
have the same checksum value, the likelihood that this would happen
is extremely low.</p>
<p>However UniProtKB may contain entries with identical sequences in case
of multiple genes (paralogs).</p>
<p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64)
using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1.
The algorithm is described in the ISO 3309 standard.
</p>
<p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br />
<strong>Cyclic redundancy and other checksums</strong><br />
<a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p>
Checksum:i6AE04D318BEB617C
Isoform F (identifier: Q99572-6) [UniParc]FASTAAdd to basketAdded to basketShow »
The sequence of this isoform differs from the canonical sequence as follows:
1-3: MPA → MWQ
4-292: Missing.
10 20 30 40 50
MWQFRYAKYY KENNVEKRTL IKVFGIRFDI LVFGTGGKFD IIQLVVYIGS
60 70 80 90 100
TLSYFGLAAV FIDFLIDTYS SNCCRSHIYP WCKCCQPCVV NEYYYRKKCE
110 120 130 140 150
SIVEPKPTLK YVSFVDESHI RMVNQQLLGR SLQDVKGQEV PRPAMDFTDL
160 170 180 190 200
SRLPLALHDT PPIPGQPEEI QLLRKEATPR SRDSPVWCQC GSCLPSQLPE
210 220 230 240 250
SHRCLEELCC RKKPGACITT SELFRKLVLS RHVLQFLLLY QEPLLALDVD
260 270 280 290 300
STNSRLRHCA YRCYATWRFG SQDMADFAIL PSCCRWRIRK EFPKSEGQYS
GFKSPY
Length:306
Mass (Da):35,544
<p>The checksum is a form of redundancy check that is calculated
from the sequence. It is useful for tracking sequence updates.</p>
<p>It should be noted that while, in theory, two different sequences could
have the same checksum value, the likelihood that this would happen
is extremely low.</p>
<p>However UniProtKB may contain entries with identical sequences in case
of multiple genes (paralogs).</p>
<p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64)
using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1.
The algorithm is described in the ISO 3309 standard.
</p>
<p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br />
<strong>Cyclic redundancy and other checksums</strong><br />
<a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p>
Checksum:i28004164298DC12A
Isoform G (identifier: Q99572-7) [UniParc]FASTAAdd to basketAdded to basketShow »
The sequence of this isoform differs from the canonical sequence as follows:
1-98: MPACCSCSDV...DTADYTFPLQ → MTPGDHSW
347-364: AAVFIDFLIDTYSSNCCR → VRDSLFHALGKWFGEGSD
365-595: Missing.
10 20 30 40 50
MTPGDHSWGN SFFVMTNFLK TEGQEQRLCP EYPTRRTLCS SDRGCKKGWM
60 70 80 90 100
DPQSKGIQTG RCVVYEGNQK TCEVSAWCPI EAVEEAPRPA LLNSAENFTV
110 120 130 140 150
LIKNNIDFPG HNYTTRNILP GLNITCTFHK TQNPQCPIFR LGDIFRETGD
160 170 180 190 200
NFSDVAIQGG IMGIEIYWDC NLDRWFHHCR PKYSFRRLDD KTTNVSLYPG
210 220 230 240 250
YNFRYAKYYK ENNVEKRTLI KVFGIRFDIL VFGTGGKFDI IQLVVYIGST
260 270
LSYFGLVRDS LFHALGKWFG EGSD
Length:274
Mass (Da):31,446
<p>The checksum is a form of redundancy check that is calculated
from the sequence. It is useful for tracking sequence updates.</p>
<p>It should be noted that while, in theory, two different sequences could
have the same checksum value, the likelihood that this would happen
is extremely low.</p>
<p>However UniProtKB may contain entries with identical sequences in case
of multiple genes (paralogs).</p>
<p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64)
using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1.
The algorithm is described in the ISO 3309 standard.
</p>
<p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br />
<strong>Cyclic redundancy and other checksums</strong><br />
<a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p>
Checksum:i48E9BBD37BFEFDA1
Isoform H (identifier: Q99572-8) [UniParc]FASTAAdd to basketAdded to basket
Also known as: Delta-TM1
The sequence of this isoform differs from the canonical sequence as follows:
1-98: MPACCSCSDV...DTADYTFPLQ → MTPGDHSW
10 20 30 40 50
MTPGDHSWGN SFFVMTNFLK TEGQEQRLCP EYPTRRTLCS SDRGCKKGWM
60 70 80 90 100
DPQSKGIQTG RCVVYEGNQK TCEVSAWCPI EAVEEAPRPA LLNSAENFTV
110 120 130 140 150
LIKNNIDFPG HNYTTRNILP GLNITCTFHK TQNPQCPIFR LGDIFRETGD
160 170 180 190 200
NFSDVAIQGG IMGIEIYWDC NLDRWFHHCR PKYSFRRLDD KTTNVSLYPG
210 220 230 240 250
YNFRYAKYYK ENNVEKRTLI KVFGIRFDIL VFGTGGKFDI IQLVVYIGST
260 270 280 290 300
LSYFGLAAVF IDFLIDTYSS NCCRSHIYPW CKCCQPCVVN EYYYRKKCES
310 320 330 340 350
IVEPKPTLKY VSFVDESHIR MVNQQLLGRS LQDVKGQEVP RPAMDFTDLS
360 370 380 390 400
RLPLALHDTP PIPGQPEEIQ LLRKEATPRS RDSPVWCQCG SCLPSQLPES
410 420 430 440 450
HRCLEELCCR KKPGACITTS ELFRKLVLSR HVLQFLLLYQ EPLLALDVDS
460 470 480 490 500
TNSRLRHCAY RCYATWRFGS QDMADFAILP SCCRWRIRKE FPKSEGQYSG
FKSPY
Note: Non-functional channel.
Show »Length:505
Mass (Da):58,239
<p>The checksum is a form of redundancy check that is calculated
from the sequence. It is useful for tracking sequence updates.</p>
<p>It should be noted that while, in theory, two different sequences could
have the same checksum value, the likelihood that this would happen
is extremely low.</p>
<p>However UniProtKB may contain entries with identical sequences in case
of multiple genes (paralogs).</p>
<p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64)
using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1.
The algorithm is described in the ISO 3309 standard.
</p>
<p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br />
<strong>Cyclic redundancy and other checksums</strong><br />
<a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p>
Checksum:iD65D70EADCE5702A
Experimental Info
| Feature key | Position(s) | DescriptionActions | Graphical view | Length |
|---|---|---|---|---|
| <p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti | 481 | S → R in CAA73360 (PubMed:9826911).Curated | 1 |
Natural variant
| Feature key | Position(s) | DescriptionActions | Graphical view | Length |
|---|---|---|---|---|
| <p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_036444 | 25 | N → S in a colorectal cancer sample; somatic mutation. 1 Publication <p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
| 1 | |
| <p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_057665 | 76 | V → A2 Publications <p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
| 1 | |
| <p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_079880 | 117 | R → W1 Publication <p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
| 1 | |
| <p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_079881 | 125 | R → L1 Publication <p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
| 1 | |
| <p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_079882 | 148 | Q → R1 Publication <p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
| 1 | |
| <p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_057666 | 150 | G → R Decreases cell surface expression; decreases phagocytosis activity. 2 Publications <p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
| 1 | |
| <p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_019649 | 155 | Y → H6 Publications <p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
| 1 | |
| <p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_079883 | 205 | T → M Polymorphism; may influence susceptibility to multiple sclerosis in the presence of variant S-135 in P2RX4; decreases cell surface expression; decreases pore complex assembly; decreases phagocytosis activity. 1 Publication <p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
| 1 | |
| <p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_079884 | 264 | R → H1 Publication <p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
| 1 | |
| <p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_057667 | 270 | R → C. Corresponds to variant dbSNP:rs16950860Ensembl. | 1 | |
| <p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_019648 | 270 | R → H5 Publications <p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
| 1 | |
| <p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_057668 | 276 | R → H2 Publications <p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
| 1 | |
| <p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_079885 | 288 | Y → H1 Publication <p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
| 1 | |
| <p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_057669 | 307 | R → Q Polymorphism; results in a loss of function. 3 Publications <p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
| 1 | |
| <p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_057670 | 348 | A → T3 Publications <p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
| 1 | |
| <p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_019650 | 357 | T → S3 Publications <p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
| 1 | |
| <p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_079886 | 361 | N → S Polymorphism; may influence susceptibility to multiple sclerosis in the presence of variant S-135 in P2RX4; no effect on cell surface expression; no effect on pore complex assembly. 1 Publication <p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
| 1 | |
| <p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_057671 | 430 | P → R. Corresponds to variant dbSNP:rs10160951Ensembl. | 1 | |
| <p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_057672 | 433 | A → V1 Publication <p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
| 1 | |
| <p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_019651 | 460 | Q → R2 Publications <p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
| 1 | |
| <p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_019652 | 496 | E → A Polymorphism; results in a loss of function. 4 Publications <p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
| 1 | |
| <p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_057673 | 521 | H → Q1 Publication <p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
| 1 | |
| <p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_057674 | 522 | V → I1 Publication <p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
| 1 | |
| <p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_079887 | 535 | A → V1 Publication <p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
| 1 | |
| <p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_079888 | 544 | R → Q1 Publication <p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
| 1 | |
| <p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_068011 | 568 | I → N Polymorphism; results in trafficking defect and around 50% loss of function. 4 Publications <p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
| 1 | |
| <p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_036445 | 574 | R → L in a colorectal cancer sample; somatic mutation. 1 Publication <p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
| 1 | |
| <p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_057675 | 578 | R → Q. Corresponds to variant dbSNP:rs28360460EnsemblClinVar. | 1 |
Alternative sequence
| Feature key | Position(s) | DescriptionActions | Graphical view | Length |
|---|---|---|---|---|
| <p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_047776 | 1 – 98 | MPACC…TFPLQ → MTPGDHSW in isoform G and isoform H. 1 Publication <p>Manually curated information that is based on statements in scientific articles for which there is no experimental support.</p> <p><a href="/manual/evidences#ECO:0000303">More...</a></p> Manual assertion based on opinion ini
| 98 | |
| <p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_047777 | 1 – 7 | MPACCSC → MDGPAEQ in isoform D. 2 Publications <p>Manually curated information that is based on statements in scientific articles for which there is no experimental support.</p> <p><a href="/manual/evidences#ECO:0000303">More...</a></p> Manual assertion based on opinion ini
| 7 | |
| <p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_047778 | 1 – 3 | MPA → MWQ in isoform F. 1 Publication <p>Manually curated information that is based on statements in scientific articles for which there is no experimental support.</p> <p><a href="/manual/evidences#ECO:0000303">More...</a></p> Manual assertion based on opinion ini
| 3 | |
| <p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_047779 | 4 – 292 | Missing in isoform F. 1 Publication <p>Manually curated information that is based on statements in scientific articles for which there is no experimental support.</p> <p><a href="/manual/evidences#ECO:0000303">More...</a></p> Manual assertion based on opinion ini
| 289 | |
| <p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_047780 | 8 – 177 | Missing in isoform D. 2 Publications <p>Manually curated information that is based on statements in scientific articles for which there is no experimental support.</p> <p><a href="/manual/evidences#ECO:0000303">More...</a></p> Manual assertion based on opinion ini
| 170 | |
| <p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_047781 | 122 – 128 | YPTRRTL → EFRPEGV in isoform C. 2 Publications <p>Manually curated information that is based on statements in scientific articles for which there is no experimental support.</p> <p><a href="/manual/evidences#ECO:0000303">More...</a></p> Manual assertion based on opinion ini
| 7 | |
| <p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_047782 | 129 – 595 | Missing in isoform C. 2 Publications <p>Manually curated information that is based on statements in scientific articles for which there is no experimental support.</p> <p><a href="/manual/evidences#ECO:0000303">More...</a></p> Manual assertion based on opinion ini
| 467 | |
| <p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_047783 | 206 – 294 | Missing in isoform E. 1 Publication <p>Manually curated information that is based on statements in scientific articles for which there is no experimental support.</p> <p><a href="/manual/evidences#ECO:0000303">More...</a></p> Manual assertion based on opinion ini
| 89 | |
| <p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_047784 | 347 – 364 | AAVFI…SNCCR → VRDSLFHALGKWFGEGSD in isoform B, isoform E and isoform G. 1 Publication <p>Manually curated information that is based on statements in scientific articles for which there is no experimental support.</p> <p><a href="/manual/evidences#ECO:0000303">More...</a></p> Manual assertion based on opinion ini
| 18 | |
| <p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_047785 | 365 – 595 | Missing in isoform B, isoform E and isoform G. 1 Publication <p>Manually curated information that is based on statements in scientific articles for which there is no experimental support.</p> <p><a href="/manual/evidences#ECO:0000303">More...</a></p> Manual assertion based on opinion ini
| 231 |
Sequence databases
| Select the link destinations: EMBL nucleotide sequence database More...EMBLiGenBank nucleotide sequence database More...GenBankiDNA Data Bank of Japan; a nucleotide sequence database More...DDBJiLinks Updated | Y09561 mRNA Translation: CAA70755.1 Y12851 , Y12852, Y12853, Y12854, Y12855 Genomic DNA Translation: CAA73360.1 AY847298 mRNA Translation: AAX82087.1 AY847299 mRNA Translation: AAX82088.1 AY847300 mRNA Translation: AAX82089.1 AY847301 mRNA Translation: AAX82090.1 AY847302 mRNA Translation: AAX82091.1 AY847303 mRNA Translation: AAX82092.1 AY847304 mRNA Translation: AAX82093.1 AK290405 mRNA Translation: BAF83094.1 AK294126 mRNA Translation: BAH11678.1 AC069209 Genomic DNA No translation available. AC079602 Genomic DNA No translation available. Z98941 Genomic DNA No translation available. BC007679 mRNA Translation: AAH07679.1 BC011913 mRNA Translation: AAH11913.1 |
The Consensus CDS (CCDS) project More...CCDSi | CCDS9213.1 [Q99572-1] |
NCBI Reference Sequences More...RefSeqi | NP_002553.3, NM_002562.5 [Q99572-1] XP_011536722.1, XM_011538420.2 [Q99572-6] |
UniGene gene-oriented nucleotide sequence clusters More...UniGenei | Hs.439682 Hs.729169 |
Genome annotation databases
Ensembl eukaryotic genome annotation project More...Ensembli | ENST00000328963; ENSP00000330696; ENSG00000089041 [Q99572-1] ENST00000535250; ENSP00000442572; ENSG00000089041 [Q99572-2] ENST00000535600; ENSP00000442470; ENSG00000089041 [Q99572-5] ENST00000541022; ENSP00000441230; ENSG00000089041 [Q99572-3] ENST00000541716; ENSP00000437729; ENSG00000089041 [Q99572-3] |
Database of genes from NCBI RefSeq genomes More...GeneIDi | 5027 |
KEGG: Kyoto Encyclopedia of Genes and Genomes More...KEGGi | hsa:5027 |
UCSC genome browser More...UCSCi | uc001tzm.4 human [Q99572-1] |
<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Coding sequence diversityi
Alternative splicing, Polymorphism<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi
| Protein | Similar proteins | Species | Score | Length | |
|---|---|---|---|---|---|
| Q99572-2 | P2X purinoceptor | 364 | |||
| cDNA FLJ33547 fis, clone BRAMY2008977, highly similar to P2X PURINOCEPTOR 7 | 260 | ||||
| Q99572-3 | P2RX7 isoform 6 | 128 | |||
| P2RX7 isoform 5 | 128 |
| Protein | Similar proteins | Species | Score | Length | |
|---|---|---|---|---|---|
| Q99572 | UPI0007DC8193 | 344 | |||
| P2X purinoceptor | 595 | ||||
| P2X purinoceptor | 595 | ||||
| P2X purinoceptor | 595 | ||||
| P2X purinoceptor | 595 | ||||
| +34 | |||||
| Q99572-2 | P2X purinoceptor | 364 | |||
| cDNA FLJ33547 fis, clone BRAMY2008977, highly similar to P2X PURINOCEPTOR 7 | 260 | ||||
| P2X purinoceptor | 364 | ||||
| p2X purinoceptor (Fragment) | 385 | ||||
| p2X purinoceptor | 364 | ||||
| Q99572-3 | P2RX7 isoform 6 | 128 | |||
| P2RX7 isoform 5 | 128 | ||||
| Q99572-5 | P2RX7 isoform 7 | 275 | |||
| P2RX7 isoform 7 | 275 | ||||
| Protein | Similar proteins | Species | Score | Length | |
|---|---|---|---|---|---|
| Q99572 | UPI0007DC8193 | 344 | |||
| P2X purinoceptor | 595 | ||||
| P2X purinoceptor | 595 | ||||
| P2X purinoceptor | 595 | ||||
| P2X purinoceptor | 595 | ||||
| +82 | |||||
| Q99572-2 | P2X purinoceptor | 364 | |||
| cDNA FLJ33547 fis, clone BRAMY2008977, highly similar to P2X PURINOCEPTOR 7 | 260 | ||||
| P2X purinoceptor | 364 | ||||
| p2X purinoceptor 7 (Fragment) | 324 | ||||
| p2X purinoceptor 7 (Fragment) | 324 | ||||
| +10 | |||||
| Q99572-3 | P2RX7 isoform 6 | 128 | |||
| P2RX7 isoform 5 | 128 | ||||
| UPI0002ADB7DA | 104 | ||||
| P2X purinoceptor 7 | 127 | ||||
| Purinergic receptor P2X 7 | 128 | ||||
| +18 | |||||
| Q99572-5 | P2RX7 isoform 7 | 275 | |||
| P2RX7 isoform 7 | 275 | ||||
| UPI000949B5E6 | 342 | ||||
| Q99572-6 | Uncharacterized protein | 307 | |||
| UPI0003C00577 | 290 | ||||
| UPI0004542317 | 340 | ||||
| Q99572-7 | UPI000981D0B8 | 294 | |||
| Purinergic receptor P2X, ligand-gated ion channel, 7 (Fragment) | 310 | ||||
<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi
<p>This subsection of the <a href="http://www.uniprot.org/manual/cross_references_section">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi
| Atlas of Genetics and Cytogenetics in Oncology and Haematology |
| Wikipedia P2X receptor entry |
| Wikipedia P2RX7 entry |
Sequence databases
| Select the link destinations: EMBL nucleotide sequence database More...EMBLiGenBank nucleotide sequence database More...GenBankiDNA Data Bank of Japan; a nucleotide sequence database More...DDBJiLinks Updated | Y09561 mRNA Translation: CAA70755.1 Y12851 , Y12852, Y12853, Y12854, Y12855 Genomic DNA Translation: CAA73360.1 AY847298 mRNA Translation: AAX82087.1 AY847299 mRNA Translation: AAX82088.1 AY847300 mRNA Translation: AAX82089.1 AY847301 mRNA Translation: AAX82090.1 AY847302 mRNA Translation: AAX82091.1 AY847303 mRNA Translation: AAX82092.1 AY847304 mRNA Translation: AAX82093.1 AK290405 mRNA Translation: BAF83094.1 AK294126 mRNA Translation: BAH11678.1 AC069209 Genomic DNA No translation available. AC079602 Genomic DNA No translation available. Z98941 Genomic DNA No translation available. BC007679 mRNA Translation: AAH07679.1 BC011913 mRNA Translation: AAH11913.1 |
The Consensus CDS (CCDS) project More...CCDSi | CCDS9213.1 [Q99572-1] |
NCBI Reference Sequences More...RefSeqi | NP_002553.3, NM_002562.5 [Q99572-1] XP_011536722.1, XM_011538420.2 [Q99572-6] |
UniGene gene-oriented nucleotide sequence clusters More...UniGenei | Hs.439682 Hs.729169 |
3D structure databases
Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase More...ProteinModelPortali | Q99572 |
SWISS-MODEL Repository - a database of annotated 3D protein structure models More...SMRi | Q99572 |
Database of comparative protein structure models More...ModBasei | Search... |
MobiDB: a database of protein disorder and mobility annotations More...MobiDBi | Search... |
Protein-protein interaction databases
The Biological General Repository for Interaction Datasets (BioGrid) More...BioGridi | 111066, 5 interactors |
The Eukaryotic Linear Motif resource for Functional Sites in Proteins More...ELMi | Q99572 |
Protein interaction database and analysis system More...IntActi | Q99572, 16 interactors |
STRING: functional protein association networks More...STRINGi | 9606.ENSP00000442349 |
Chemistry databases
BindingDB database of measured binding affinities More...BindingDBi | Q99572 |
ChEMBL database of bioactive drug-like small molecules More...ChEMBLi | CHEMBL4805 |
IUPHAR/BPS Guide to PHARMACOLOGY More...GuidetoPHARMACOLOGYi | 484 |
Protein family/group databases
Transport Classification Database More...TCDBi | 1.A.7.1.3 the atp-gated p2x receptor cation channel (p2x receptor) family |
PTM databases
iPTMnet integrated resource for PTMs in systems biology context More...iPTMneti | Q99572 |
Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat. More...PhosphoSitePlusi | Q99572 |
SwissPalm database of S-palmitoylation events More...SwissPalmi | Q99572 |
Polymorphism and mutation databases
BioMuta curated single-nucleotide variation and disease association database More...BioMutai | P2RX7 |
Domain mapping of disease mutations (DMDM) More...DMDMi | 395398617 |
Proteomic databases
PaxDb, a database of protein abundance averages across all three domains of life More...PaxDbi | Q99572 |
PeptideAtlas More...PeptideAtlasi | Q99572 |
PRoteomics IDEntifications database More...PRIDEi | Q99572 |
ProteomicsDB human proteome resource More...ProteomicsDBi | 78332 |
Protocols and materials databases
| Structural Biology Knowledgebase | Search... |
Genome annotation databases
Ensembl eukaryotic genome annotation project More...Ensembli | ENST00000328963; ENSP00000330696; ENSG00000089041 [Q99572-1] ENST00000535250; ENSP00000442572; ENSG00000089041 [Q99572-2] ENST00000535600; ENSP00000442470; ENSG00000089041 [Q99572-5] ENST00000541022; ENSP00000441230; ENSG00000089041 [Q99572-3] ENST00000541716; ENSP00000437729; ENSG00000089041 [Q99572-3] |
Database of genes from NCBI RefSeq genomes More...GeneIDi | 5027 |
KEGG: Kyoto Encyclopedia of Genes and Genomes More...KEGGi | hsa:5027 |
UCSC genome browser More...UCSCi | uc001tzm.4 human [Q99572-1] |
Organism-specific databases
Comparative Toxicogenomics Database More...CTDi | 5027 |
DisGeNET More...DisGeNETi | 5027 |
Eukaryotic Pathogen Database Resources More...EuPathDBi | HostDB:ENSG00000089041.16 |
GeneCards: human genes, protein and diseases More...GeneCardsi | P2RX7 |
Human Gene Nomenclature Database More...HGNCi | HGNC:8537 P2RX7 |
Human Protein Atlas More...HPAi | HPA034967 HPA034968 HPA042013 HPA044141 |
MalaCards human disease database More...MalaCardsi | P2RX7 |
Online Mendelian Inheritance in Man (OMIM) More...MIMi | 602566 gene |
neXtProt; the human protein knowledge platform More...neXtProti | NX_Q99572 |
Open Targets More...OpenTargetsi | ENSG00000089041 |
The Pharmacogenetics and Pharmacogenomics Knowledge Base More...PharmGKBi | PA32866 |
GenAtlas: human gene database More...GenAtlasi | Search... |
Phylogenomic databases
evolutionary genealogy of genes: Non-supervised Orthologous Groups More...eggNOGi | ENOG410IK4U Eukaryota ENOG4110DDY LUCA |
Ensembl GeneTree More...GeneTreei | ENSGT00390000016028 |
The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms More...HOGENOMi | HOG000232042 |
The HOVERGEN Database of Homologous Vertebrate Genes More...HOVERGENi | HBG053086 |
InParanoid: Eukaryotic Ortholog Groups More...InParanoidi | Q99572 |
KEGG Orthology (KO) More...KOi | K05220 |
Identification of Orthologs from Complete Genome Data More...OMAi | YPGYNFR |
Database of Orthologous Groups More...OrthoDBi | EOG091G0A2U |
TreeFam database of animal gene trees More...TreeFami | TF328633 |
Enzyme and pathway databases
Reactome - a knowledgebase of biological pathways and processes More...Reactomei | R-HSA-139853 Elevation of cytosolic Ca2+ levels R-HSA-418346 Platelet homeostasis R-HSA-844456 The NLRP3 inflammasome |
SignaLink: a signaling pathway resource with multi-layered regulatory networks More...SignaLinki | Q99572 |
SIGNOR Signaling Network Open Resource More...SIGNORi | Q99572 |
Miscellaneous databases
ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data More...ChiTaRSi | P2RX7 human |
The Gene Wiki collection of pages on human genes and proteins More...GeneWikii | P2RX7 |
Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens More...GenomeRNAii | 5027 |
Protein Ontology More...PROi | PR:Q99572 |
The Stanford Online Universal Resource for Clones and ESTs More...SOURCEi | Search... |
Gene expression databases
Bgee dataBase for Gene Expression Evolution More...Bgeei | ENSG00000089041 |
CleanEx database of gene expression profiles More...CleanExi | HS_P2RX7 |
ExpressionAtlas, Differential and Baseline Expression More...ExpressionAtlasi | Q99572 baseline and differential |
Genevisible search portal to normalized and curated expression data from Genevestigator More...Genevisiblei | Q99572 HS |
Family and domain databases
Gene3D Structural and Functional Annotation of Protein Families More...Gene3Di | 2.60.490.10, 1 hit |
Integrated resource of protein families, domains and functional sites More...InterProi | View protein in InterPro IPR003050 P2X7_purinoceptor IPR027309 P2X_extracellular_dom_sf IPR001429 P2X_purnocptor |
The PANTHER Classification System More...PANTHERi | PTHR10125 PTHR10125, 1 hit PTHR10125:SF13 PTHR10125:SF13, 1 hit |
Pfam protein domain database More...Pfami | View protein in Pfam PF00864 P2X_receptor, 1 hit |
Protein Motif fingerprint database; a protein domain database More...PRINTSi | PR01314 P2X7RECEPTOR PR01307 P2XRECEPTOR |
TIGRFAMs; a protein family database More...TIGRFAMsi | TIGR00863 P2X, 1 hit |
PROSITE; a protein domain and family database More...PROSITEi | View protein in PROSITE PS01212 P2X_RECEPTOR, 1 hit |
ProtoNet; Automatic hierarchical classification of proteins More...ProtoNeti | Search... |
<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi
| <p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry namei | P2RX7_HUMAN | |
| <p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>Accessioni | Q99572Primary (citable) accession number: Q99572 Secondary accession number(s): A8K2Z0 , E7EMK6, F5H6P2, F5H7E8, F8W951, O14991, Q4VKH8, Q4VKH9, Q4VKI0, Q4VKI1, Q4VKI2, Q4VKI3, Q4VKI4, Q7Z771, Q96EV7 | |
| <p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyi | Integrated into UniProtKB/Swiss-Prot: | November 1, 1997 |
| Last sequence update: | July 11, 2012 | |
| Last modified: | July 18, 2018 | |
| This is version 179 of the entry and version 4 of the sequence. See complete history. | ||
| <p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusi | Reviewed (UniProtKB/Swiss-Prot) | |
| Annotation program | Chordata Protein Annotation Program | |
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | |
<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi
<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Technical termi
Complete proteome, Reference proteomeDocuments
- Human chromosome 12
Human chromosome 12: entries, gene names and cross-references to MIM - Human entries with polymorphisms or disease mutations
List of human entries with polymorphisms or disease mutations - Human polymorphisms and disease mutations
Index of human polymorphisms and disease mutations - MIM cross-references
Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot - SIMILARITY comments
Index of protein domains and families
