Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 160 (07 Apr 2021)
Sequence version 4 (09 Jul 2014)
Previous versions | rss
Add a publicationFeedback
Protein

M-phase phosphoprotein 9

Gene

MPHOSPH9

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:4 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...
PathwayCommonsi
Q99550

SIGNOR Signaling Network Open Resource

More...
SIGNORi
Q99550

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
M-phase phosphoprotein 9
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:MPHOSPH9
Synonyms:MPP9
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 12

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:7215, MPHOSPH9

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
605501, gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q99550

Eukaryotic Pathogen, Vector and Host Database Resources

More...
VEuPathDBi
HostDB:ENSG00000051825.14

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Cytoplasm, Cytoskeleton, Golgi apparatus, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
10198

Open Targets

More...
OpenTargetsi
ENSG00000051825

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA30921

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q99550, Tbio

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
MPHOSPH9

Domain mapping of disease mutations (DMDM)

More...
DMDMi
215274134

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000965571 – 1183M-phase phosphoprotein 9Add BLAST1183

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei994PhosphoserineCombined sources1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Phosphorylated in M (mitotic) phase.1 Publication

Keywords - PTMi

Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q99550

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q99550

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q99550

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q99550

PeptideAtlas

More...
PeptideAtlasi
Q99550

PRoteomics IDEntifications database

More...
PRIDEi
Q99550

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
78323 [Q99550-1]
78324 [Q99550-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q99550

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q99550

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000051825, Expressed in lung and 196 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q99550, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q99550, HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
ENSG00000051825, Tissue enhanced (lymphoid)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
115493, 53 interactors

Protein interaction database and analysis system

More...
IntActi
Q99550, 32 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000475489

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q99550, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q99550

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and domains' section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili609 – 804Sequence analysisAdd BLAST196
Coiled coili1109 – 1174Sequence analysisAdd BLAST66

Keywords - Domaini

Coiled coil

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG4713, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00500000044984

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_008784_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q99550

Identification of Orthologs from Complete Genome Data

More...
OMAi
KNCETRW

Database of Orthologous Groups

More...
OrthoDBi
572984at2759

TreeFam database of animal gene trees

More...
TreeFami
TF336168

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR026636, MPHOSPH9

The PANTHER Classification System

More...
PANTHERi
PTHR14926, PTHR14926, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 13 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q99550-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MEEFDLVKTL HKTSSSVGSD ENSLHSLGLN LNTDRSSPHL STNGVSSFSG
60 70 80 90 100
KTRPSVIQGT VEVLTSLMQE LQNSGKTDSE LWKNCETRWL QLFNLVEKQC
110 120 130 140 150
QEQIVAQQEQ FHNQIQHIQE EIKNLVKLQT SSASLASCEG NSSNKQVSSE
160 170 180 190 200
SQMGFFSLSS ERNESVIHYP ESTEPEIQQE MSTSQPDCNV DSCSVSSGYG
210 220 230 240 250
TFCISELNLY KSKDPKEFME HIDVPKGQYV APAVPAESLV DGVKNENFYI
260 270 280 290 300
QTPEECHVSL KEDVSISPGE FEHNFLGENK VSEVYSGKTN SNAITSWAQK
310 320 330 340 350
LKQNQPKRAH VEDGGSRSKQ GNEQSKKTPI EKSDFAAATH PRAFYLSKPD
360 370 380 390 400
ETPNAWMSDS GTGLTYWKLE EKDMHHSLPE TLEKTFISLS STDVSPNQSN
410 420 430 440 450
TSNEMKLPSL KDIYYKKQRE NKQLPERNLT SASNPNHPPE VLTLDPTLHM
460 470 480 490 500
KPKQQISGIQ PHGLPNALDD RISFSPDSVL EPSMSSPSDI DSFSQASNVT
510 520 530 540 550
SQLPGFPKYP SHTKASPVDS WKNQTFQNES RTSSTFPSVY TITSNDISVN
560 570 580 590 600
TVDEENTVMV ASASVSQSQL PGTANSVPEC ISLTSLEDPV ILSKIRQNLK
610 620 630 640 650
EKHARHIADL RAYYESEINS LKQKLEAKEI SGVEDWKITN QILVDRCGQL
660 670 680 690 700
DSALHEATSR VRTLENKNNL LEIEVNDLRE RFSAASSASK ILQERIEEMR
710 720 730 740 750
TSSKEKDNTI IRLKSRLQDL EEAFENAYKL SDDKEAQLKQ ENKMFQDLLG
760 770 780 790 800
EYESLGKEHR RVKDALNTTE NKLLDAYTQI SDLKRMISKL EAQVKQVEHE
810 820 830 840 850
NMLSLRHNSR IHVRPSRANT LATSDVSRRK WLIPGAEYSI FTGQPLDTQD
860 870 880 890 900
SNVDNQLEET CSLGHRSPLE KDSSPGSSST SLLIKKQRET SDTPIMRALK
910 920 930 940 950
ELDEGKIFKN WGTQTEKEDT SNINPRQTET SVNASRSPEK CAQQRQKRLN
960 970 980 990 1000
SASQRSSSLP PSNRKSSTPT KREIMLTPVT VAYSPKRSPK ENLSPGFSHL
1010 1020 1030 1040 1050
LSKNESSPIR FDILLDDLDT VPVSTLQRTN PRKQLQFLPL DDSEEKTYSE
1060 1070 1080 1090 1100
KATDNHVNHS SCPEPVPNGV KKVSVRTAWE KNKSVSYEQC KPVSVTPQGN
1110 1120 1130 1140 1150
DFEYTAKIRT LAETERFFDE LTKEKDQIEA ALSRMPSPGG RITLQTRLNQ
1160 1170 1180
EALEDRLERI NRELGSVRMT LKKFHVLRTS ANL
Length:1,183
Mass (Da):133,024
Last modified:July 9, 2014 - v4
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i035ABB95C20547E4
GO
Isoform 2 (identifier: Q99550-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1151-1183: EALEDRLERINRELGSVRMTLKKFHVLRTSANL → TPQICEESSHKCAFAGHYVPCHLYDYRFQG

Show »
Length:1,180
Mass (Da):132,615
Checksum:iE663949CB98D606B
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 13 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
F5H1U6F5H1U6_HUMAN
M-phase phosphoprotein 9
MPHOSPH9
215Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YG46H0YG46_HUMAN
M-phase phosphoprotein 9
MPHOSPH9
675Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0A0MTP3A0A0A0MTP3_HUMAN
M-phase phosphoprotein 9
MPHOSPH9
1,153Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
J3KNE4J3KNE4_HUMAN
M-phase phosphoprotein 9
MPHOSPH9
840Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F5H1W2F5H1W2_HUMAN
M-phase phosphoprotein 9
MPHOSPH9
84Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YFS3H0YFS3_HUMAN
M-phase phosphoprotein 9
MPHOSPH9
363Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
U3KQJ0U3KQJ0_HUMAN
M-phase phosphoprotein 9
MPHOSPH9
163Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F5H2I5F5H2I5_HUMAN
M-phase phosphoprotein 9
MPHOSPH9
89Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F5H798F5H798_HUMAN
M-phase phosphoprotein 9
MPHOSPH9
46Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F5GYP5F5GYP5_HUMAN
M-phase phosphoprotein 9
MPHOSPH9
126Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
There are more potential isoformsShow all

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAB14359 differs from that shown. Reason: Erroneous initiation. Truncated N-terminus.Curated
The sequence BAG52299 differs from that shown. Reason: Erroneous initiation. Truncated N-terminus.Curated
The sequence EAW98394 differs from that shown. Reason: Erroneous gene model prediction.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti947K → E in BAB14359 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_047643277G → S1 PublicationCorresponds to variant dbSNP:rs36121382Ensembl.1
Natural variantiVAR_0476441078A → D. Corresponds to variant dbSNP:rs1260318Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0358381151 – 1183EALED…TSANL → TPQICEESSHKCAFAGHYVP CHLYDYRFQG in isoform 2. 1 PublicationAdd BLAST33

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AC068768 Genomic DNA No translation available.
AC073857 Genomic DNA No translation available.
CH471054 Genomic DNA Translation: EAW98392.1
CH471054 Genomic DNA Translation: EAW98394.1 Sequence problems.
AK023016 mRNA Translation: BAB14359.1 Different initiation.
AK091181 mRNA Translation: BAG52299.1 Different initiation.
BC130440 mRNA Translation: AAI30441.1
X98258 mRNA Translation: CAA66911.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS9243.2 [Q99550-1]

NCBI Reference Sequences

More...
RefSeqi
NP_073619.3, NM_022782.3 [Q99550-1]
XP_016874162.1, XM_017018673.1 [Q99550-1]
XP_016874168.1, XM_017018679.1
XP_016874169.1, XM_017018680.1

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000606320; ENSP00000475489; ENSG00000051825 [Q99550-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
10198

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:10198

UCSC genome browser

More...
UCSCi
uc001uel.5, human [Q99550-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AC068768 Genomic DNA No translation available.
AC073857 Genomic DNA No translation available.
CH471054 Genomic DNA Translation: EAW98392.1
CH471054 Genomic DNA Translation: EAW98394.1 Sequence problems.
AK023016 mRNA Translation: BAB14359.1 Different initiation.
AK091181 mRNA Translation: BAG52299.1 Different initiation.
BC130440 mRNA Translation: AAI30441.1
X98258 mRNA Translation: CAA66911.1
CCDSiCCDS9243.2 [Q99550-1]
RefSeqiNP_073619.3, NM_022782.3 [Q99550-1]
XP_016874162.1, XM_017018673.1 [Q99550-1]
XP_016874168.1, XM_017018679.1
XP_016874169.1, XM_017018680.1

3D structure databases

SMRiQ99550
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi115493, 53 interactors
IntActiQ99550, 32 interactors
STRINGi9606.ENSP00000475489

PTM databases

iPTMnetiQ99550
PhosphoSitePlusiQ99550

Genetic variation databases

BioMutaiMPHOSPH9
DMDMi215274134

Proteomic databases

EPDiQ99550
jPOSTiQ99550
MassIVEiQ99550
PaxDbiQ99550
PeptideAtlasiQ99550
PRIDEiQ99550
ProteomicsDBi78323 [Q99550-1]
78324 [Q99550-2]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
31757, 172 antibodies

Genome annotation databases

EnsembliENST00000606320; ENSP00000475489; ENSG00000051825 [Q99550-1]
GeneIDi10198
KEGGihsa:10198
UCSCiuc001uel.5, human [Q99550-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
10198
DisGeNETi10198

GeneCards: human genes, protein and diseases

More...
GeneCardsi
MPHOSPH9
HGNCiHGNC:7215, MPHOSPH9
HPAiENSG00000051825, Tissue enhanced (lymphoid)
MIMi605501, gene
neXtProtiNX_Q99550
OpenTargetsiENSG00000051825
PharmGKBiPA30921
VEuPathDBiHostDB:ENSG00000051825.14

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG4713, Eukaryota
GeneTreeiENSGT00500000044984
HOGENOMiCLU_008784_0_0_1
InParanoidiQ99550
OMAiKNCETRW
OrthoDBi572984at2759
TreeFamiTF336168

Enzyme and pathway databases

PathwayCommonsiQ99550
SIGNORiQ99550

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
10198, 4 hits in 893 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
MPHOSPH9, human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
10198
PharosiQ99550, Tbio

Protein Ontology

More...
PROi
PR:Q99550
RNActiQ99550, protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000051825, Expressed in lung and 196 other tissues
ExpressionAtlasiQ99550, baseline and differential
GenevisibleiQ99550, HS

Family and domain databases

InterProiView protein in InterPro
IPR026636, MPHOSPH9
PANTHERiPTHR14926, PTHR14926, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiMPP9_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q99550
Secondary accession number(s): A1L486
, A6NEE2, B3KR87, Q9H976, U3KQ28
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 30, 2000
Last sequence update: July 9, 2014
Last modified: April 7, 2021
This is version 160 of the entry and version 4 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Human chromosome 12
    Human chromosome 12: entries, gene names and cross-references to MIM
  2. Human entries with genetic variants
    List of human entries with genetic variants
  3. Human variants curated from literature reports
    Index of human variants curated from literature reports
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again