Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 180 (11 Dec 2019)
Sequence version 1 (01 May 1997)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Legumain

Gene

LGMN

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Has a strict specificity for hydrolysis of asparaginyl bonds. Can also cleave aspartyl bonds slowly, especially under acidic conditions. Required for normal lysosomal protein degradation in renal proximal tubules. Required for normal degradation of internalized EGFR. Plays a role in the regulation of cell proliferation via its role in EGFR degradation (By similarity). May be involved in the processing of proteins for MHC class II antigen presentation in the lysosomal/endosomal system.By similarity1 Publication

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

  • Hydrolysis of proteins and small molecule substrates at -Asn-|-Xaa- bonds.1 Publication EC:3.4.22.34

<p>This subsection of the ‘Function’ section describes biophysical and chemical properties, such as maximal absorption, kinetic parameters, pH dependence, redox potentials and temperature dependence.<p><a href='/help/biophysicochemical_properties' target='_top'>More...</a></p>pH dependencei

Optimum pH is 5.5 for the free enzyme, and pH 6 in the presence of bound integrins.1 Publication

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei1481 Publication1
Active sitei189Nucleophile1 Publication1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionHydrolase, Protease, Thiol protease

Enzyme and pathway databases

BRENDA Comprehensive Enzyme Information System

More...
BRENDAi
3.4.22.34 2681

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-1679131 Trafficking and processing of endosomal TLR
R-HSA-196791 Vitamin D (calciferol) metabolism
R-HSA-2132295 MHC class II antigen presentation

SABIO-RK: Biochemical Reaction Kinetics Database

More...
SABIO-RKi
Q99538

Protein family/group databases

MEROPS protease database

More...
MEROPSi
C13.004

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Legumain (EC:3.4.22.34)
Alternative name(s):
Asparaginyl endopeptidase
Protease, cysteine 1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:LGMN
Synonyms:PRSC1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 14

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000100600.14

Human Gene Nomenclature Database

More...
HGNCi
HGNC:9472 LGMN

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
602620 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q99538

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Lysosome

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi190E → K: Increases catalytic activity at pH 5.5. 1 Publication1
Mutagenesisi323N → D, Q or S: Loss of autoactivation. 1

Organism-specific databases

DisGeNET

More...
DisGeNETi
5641

Open Targets

More...
OpenTargetsi
ENSG00000100600

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA30354

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q99538 Tchem

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...
ChEMBLi
CHEMBL4244

IUPHAR/BPS Guide to PHARMACOLOGY

More...
GuidetoPHARMACOLOGYi
2380

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
LGMN

Domain mapping of disease mutations (DMDM)

More...
DMDMi
2842759

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 171 PublicationAdd BLAST17
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000002650218 – 323LegumainAdd BLAST306
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section describes a propeptide, which is a part of a protein that is cleaved during maturation or activation. Once cleaved, a propeptide generally has no independent biological function.<p><a href='/help/propep' target='_top'>More...</a></p>PropeptideiPRO_0000026503324 – 433Add BLAST110

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi91N-linked (GlcNAc...) asparagine2 Publications1
Glycosylationi167N-linked (GlcNAc...) asparagine2 Publications1
Glycosylationi263N-linked (GlcNAc...) asparagine1 Publication1
Glycosylationi272N-linked (GlcNAc...) asparagine1 Publication1
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi378 ↔ 412By similarity
Disulfide bondi390 ↔ 429By similarity

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Glycosylated.2 Publications
Activated by autocatalytic processing at pH 4.1 Publication

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection describes interesting single amino acid sites on the sequence that are not defined in any other subsection. This subsection can be displayed in different sections (‘Function’, ‘PTM / Processing’, ‘Pathology and Biotech’) according to its content.<p><a href='/help/site' target='_top'>More...</a></p>Sitei323 – 324Cleavage; by autolysis2

Keywords - PTMi

Disulfide bond, Glycoprotein, Zymogen

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q99538

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q99538

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q99538

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q99538

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q99538

PeptideAtlas

More...
PeptideAtlasi
Q99538

PRoteomics IDEntifications database

More...
PRIDEi
Q99538

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
69735
69736
78313 [Q99538-1]

PTM databases

GlyConnect protein glycosylation platform

More...
GlyConnecti
1449

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q99538

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q99538

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Ubiquitous. Particularly abundant in kidney, heart and placenta.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000100600 Expressed in 231 organ(s), highest expression level in synovial joint

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q99538 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q99538 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA001426

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Homodimer before autocatalytic removal of the propeptide (By similarity). Monomer after autocatalytic processing. May interact with integrins.

By similarity1 Publication

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
111624, 21 interactors

Protein interaction database and analysis system

More...
IntActi
Q99538, 14 interactors

Molecular INTeraction database

More...
MINTi
Q99538

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000376911

Chemistry databases

BindingDB database of measured binding affinities

More...
BindingDBi
Q99538

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q99538 protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1433
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q99538

Database of comparative protein structure models

More...
ModBasei
Search...

Protein Data Bank in Europe - Knowledge Base

More...
PDBe-KBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

In the zymogen form, the uncleaved propeptide blocks access to the active site.1 Publication

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the peptidase C13 family.Curated

Keywords - Domaini

Signal

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG1348 Eukaryota
COG5206 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000154782

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000236335

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q99538

KEGG Orthology (KO)

More...
KOi
K01369

Identification of Orthologs from Complete Genome Data

More...
OMAi
IRYMYEH

Database of Orthologous Groups

More...
OrthoDBi
826971at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q99538

TreeFam database of animal gene trees

More...
TreeFami
TF313403

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR001096 Peptidase_C13

The PANTHER Classification System

More...
PANTHERi
PTHR12000 PTHR12000, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF01650 Peptidase_C13, 1 hit

PIRSF; a whole-protein classification database

More...
PIRSFi
PIRSF019663 Legumain, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR00776 HEMOGLOBNASE

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 8 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q99538-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MVWKVAVFLS VALGIGAVPI DDPEDGGKHW VVIVAGSNGW YNYRHQADAC
60 70 80 90 100
HAYQIIHRNG IPDEQIVVMM YDDIAYSEDN PTPGIVINRP NGTDVYQGVP
110 120 130 140 150
KDYTGEDVTP QNFLAVLRGD AEAVKGIGSG KVLKSGPQDH VFIYFTDHGS
160 170 180 190 200
TGILVFPNED LHVKDLNETI HYMYKHKMYR KMVFYIEACE SGSMMNHLPD
210 220 230 240 250
NINVYATTAA NPRESSYACY YDEKRSTYLG DWYSVNWMED SDVEDLTKET
260 270 280 290 300
LHKQYHLVKS HTNTSHVMQY GNKTISTMKV MQFQGMKRKA SSPVPLPPVT
310 320 330 340 350
HLDLTPSPDV PLTIMKRKLM NTNDLEESRQ LTEEIQRHLD ARHLIEKSVR
360 370 380 390 400
KIVSLLAASE AEVEQLLSER APLTGHSCYP EALLHFRTHC FNWHSPTYEY
410 420 430
ALRHLYVLVN LCEKPYPLHR IKLSMDHVCL GHY
Length:433
Mass (Da):49,411
Last modified:May 1, 1997 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i081AD2D0D584E72A
GO
Isoform 2 (identifier: Q99538-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     341-397: Missing.

Show »
Length:376
Mass (Da):42,948
Checksum:i582E0D702B640C1F
GO
Isoform 3 (identifier: Q99538-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     341-372: ARHLIEKSVRKIVSLLAASEAEVEQLLSERAP → DKIVHGPRVPWSLLKSCLLEAFPSVSAPPTVC
     373-433: Missing.

Show »
Length:372
Mass (Da):42,008
Checksum:i915FFBB4216E8BF6
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 8 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
G3V4E4G3V4E4_HUMAN
Legumain
LGMN
223Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
G3V3Z4G3V3Z4_HUMAN
Legumain
LGMN
117Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
G3V2T4G3V2T4_HUMAN
Legumain
LGMN
135Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
G3V263G3V263_HUMAN
Legumain
LGMN
48Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
G3V4P5G3V4P5_HUMAN
Legumain
LGMN
78Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
G3V5B2G3V5B2_HUMAN
Legumain
LGMN
57Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YJN9H0YJN9_HUMAN
Legumain
LGMN
91Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
G3V2E9G3V2E9_HUMAN
Legumain
LGMN
19Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti31V → A in BAA09530 (PubMed:8893817).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_02458818V → I1 PublicationCorresponds to variant dbSNP:rs2236264Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_056454341 – 397Missing in isoform 2. 1 PublicationAdd BLAST57
Alternative sequenceiVSP_056455341 – 372ARHLI…SERAP → DKIVHGPRVPWSLLKSCLLE AFPSVSAPPTVC in isoform 3. 1 PublicationAdd BLAST32
Alternative sequenceiVSP_056456373 – 433Missing in isoform 3. 1 PublicationAdd BLAST61

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
Y09862 mRNA Translation: CAA70989.1
D55696 mRNA Translation: BAA09530.1
BX161380 mRNA Translation: CAD61872.1
BX161422 mRNA Translation: CAD61895.1
AL132987 Genomic DNA No translation available.
AL136332 Genomic DNA No translation available.
BC003061 mRNA Translation: AAH03061.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS86423.1 [Q99538-3]
CCDS86424.1 [Q99538-2]
CCDS9904.1 [Q99538-1]

NCBI Reference Sequences

More...
RefSeqi
NP_001008530.1, NM_001008530.2 [Q99538-1]
NP_005597.3, NM_005606.6 [Q99538-1]
XP_005267919.1, XM_005267862.3 [Q99538-2]
XP_005267920.1, XM_005267863.3 [Q99538-3]
XP_016876952.1, XM_017021463.1 [Q99538-1]
XP_016876953.1, XM_017021464.1 [Q99538-1]
XP_016876954.1, XM_017021465.1 [Q99538-1]
XP_016876955.1, XM_017021466.1
XP_016876956.1, XM_017021467.1

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000334869; ENSP00000334052; ENSG00000100600 [Q99538-1]
ENST00000393218; ENSP00000376911; ENSG00000100600 [Q99538-1]
ENST00000555699; ENSP00000451861; ENSG00000100600 [Q99538-3]
ENST00000557434; ENSP00000452572; ENSG00000100600 [Q99538-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
5641

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:5641

UCSC genome browser

More...
UCSCi
uc001yav.4 human [Q99538-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
Y09862 mRNA Translation: CAA70989.1
D55696 mRNA Translation: BAA09530.1
BX161380 mRNA Translation: CAD61872.1
BX161422 mRNA Translation: CAD61895.1
AL132987 Genomic DNA No translation available.
AL136332 Genomic DNA No translation available.
BC003061 mRNA Translation: AAH03061.1
CCDSiCCDS86423.1 [Q99538-3]
CCDS86424.1 [Q99538-2]
CCDS9904.1 [Q99538-1]
RefSeqiNP_001008530.1, NM_001008530.2 [Q99538-1]
NP_005597.3, NM_005606.6 [Q99538-1]
XP_005267919.1, XM_005267862.3 [Q99538-2]
XP_005267920.1, XM_005267863.3 [Q99538-3]
XP_016876952.1, XM_017021463.1 [Q99538-1]
XP_016876953.1, XM_017021464.1 [Q99538-1]
XP_016876954.1, XM_017021465.1 [Q99538-1]
XP_016876955.1, XM_017021466.1
XP_016876956.1, XM_017021467.1

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
4AW9X-ray2.20A26-309[»]
4AWAX-ray2.50A26-309[»]
4AWBX-ray2.70A/B26-309[»]
4FGUX-ray3.90A/B18-433[»]
4N6NX-ray1.87A26-303[»]
4N6OX-ray1.80A26-303[»]
5LU8X-ray1.95A26-288[»]
5LU9X-ray2.27A26-288[»]
5LUAX-ray2.00A/B26-287[»]
5LUBX-ray2.10A/B26-287[»]
SMRiQ99538
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGridi111624, 21 interactors
IntActiQ99538, 14 interactors
MINTiQ99538
STRINGi9606.ENSP00000376911

Chemistry databases

BindingDBiQ99538
ChEMBLiCHEMBL4244
GuidetoPHARMACOLOGYi2380

Protein family/group databases

MEROPSiC13.004

PTM databases

GlyConnecti1449
iPTMnetiQ99538
PhosphoSitePlusiQ99538

Polymorphism and mutation databases

BioMutaiLGMN
DMDMi2842759

Proteomic databases

EPDiQ99538
jPOSTiQ99538
MassIVEiQ99538
MaxQBiQ99538
PaxDbiQ99538
PeptideAtlasiQ99538
PRIDEiQ99538
ProteomicsDBi69735
69736
78313 [Q99538-1]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
5641

Genome annotation databases

EnsembliENST00000334869; ENSP00000334052; ENSG00000100600 [Q99538-1]
ENST00000393218; ENSP00000376911; ENSG00000100600 [Q99538-1]
ENST00000555699; ENSP00000451861; ENSG00000100600 [Q99538-3]
ENST00000557434; ENSP00000452572; ENSG00000100600 [Q99538-2]
GeneIDi5641
KEGGihsa:5641
UCSCiuc001yav.4 human [Q99538-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
5641
DisGeNETi5641
EuPathDBiHostDB:ENSG00000100600.14

GeneCards: human genes, protein and diseases

More...
GeneCardsi
LGMN
HGNCiHGNC:9472 LGMN
HPAiHPA001426
MIMi602620 gene
neXtProtiNX_Q99538
OpenTargetsiENSG00000100600
PharmGKBiPA30354

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG1348 Eukaryota
COG5206 LUCA
GeneTreeiENSGT00940000154782
HOGENOMiHOG000236335
InParanoidiQ99538
KOiK01369
OMAiIRYMYEH
OrthoDBi826971at2759
PhylomeDBiQ99538
TreeFamiTF313403

Enzyme and pathway databases

BRENDAi3.4.22.34 2681
ReactomeiR-HSA-1679131 Trafficking and processing of endosomal TLR
R-HSA-196791 Vitamin D (calciferol) metabolism
R-HSA-2132295 MHC class II antigen presentation
SABIO-RKiQ99538

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
LGMN human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
LGMN

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
5641
PharosiQ99538 Tchem

Protein Ontology

More...
PROi
PR:Q99538
RNActiQ99538 protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000100600 Expressed in 231 organ(s), highest expression level in synovial joint
ExpressionAtlasiQ99538 baseline and differential
GenevisibleiQ99538 HS

Family and domain databases

InterProiView protein in InterPro
IPR001096 Peptidase_C13
PANTHERiPTHR12000 PTHR12000, 1 hit
PfamiView protein in Pfam
PF01650 Peptidase_C13, 1 hit
PIRSFiPIRSF019663 Legumain, 1 hit
PRINTSiPR00776 HEMOGLOBNASE

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiLGMN_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q99538
Secondary accession number(s): O00123
, Q86TV2, Q86TV3, Q9BTY1
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: May 1, 1997
Last modified: December 11, 2019
This is version 180 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Direct protein sequencing, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. SIMILARITY comments
    Index of protein domains and families
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  6. Human chromosome 14
    Human chromosome 14: entries, gene names and cross-references to MIM
  7. Peptidase families
    Classification of peptidase families and list of entries
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again