Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 180 (29 Sep 2021)
Sequence version 3 (16 Jun 2009)
Previous versions | rss
Add a publicationFeedback
Protein

Eyes absent homolog 3

Gene

EYA3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Tyrosine phosphatase that specifically dephosphorylates 'Tyr-142' of histone H2AX (H2AXY142ph). 'Tyr-142' phosphorylation of histone H2AX plays a central role in DNA repair and acts as a mark that distinguishes between apoptotic and repair responses to genotoxic stress. Promotes efficient DNA repair by dephosphorylating H2AX, promoting the recruitment of DNA repair complexes containing MDC1 (PubMed:19234442, PubMed:19351884).

Its function as histone phosphatase probably explains its role in transcription regulation during organogenesis. Coactivates SIX1, and seems to coactivate SIX2, SIX4 and SIX5. The repression of precursor cell proliferation in myoblasts by SIX1 is switched to activation through recruitment of EYA3 to the SIX1-DACH1 complex and seems to be dependent on EYA3 phosphatase activity (By similarity).

May be involved in development of the eye.

By similarity2 Publications

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

<p>This subsection of the 'Function' section provides information relevant to cofactors. A cofactor is any non-protein substance required for a protein to be catalytically active. Some cofactors are inorganic, such as the metal atoms zinc, iron, and copper in various oxidation states. Others, such as most vitamins, are organic.<p><a href='/help/cofactor' target='_top'>More...</a></p>Cofactori

Mg2+By similarityNote: Binds 1 Mg2+ ion per subunit.By similarity

<p>This subsection of the 'Function' section describes biophysical and chemical properties, such as maximal absorption, kinetic parameters, pH dependence, redox potentials and temperature dependence.<p><a href='/help/biophysicochemical_properties' target='_top'>More...</a></p>Kineticsi

  1. KM=1.8 µM for H2AXY142ph1 Publication
  2. KM=72 µM for H2AXS139ph1 Publication

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei309NucleophileCurated1
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section indicates at which position the protein binds a given metal ion. The nature of the metal is indicated in the 'Description' field.<p><a href='/help/metal' target='_top'>More...</a></p>Metal bindingi309MagnesiumBy similarity1
Active sitei311Proton donorBy similarity1
Metal bindingi311Magnesium; via carbonyl oxygenBy similarity1
Metal bindingi537MagnesiumBy similarity1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionActivator, Chromatin regulator, Developmental protein, Hydrolase, Protein phosphatase
Biological processDNA damage, DNA repair, Transcription, Transcription regulation
LigandMagnesium, Metal-binding

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...
PathwayCommonsi
Q99504

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-5693565, Recruitment and ATM-mediated phosphorylation of repair and signaling proteins at DNA double strand breaks

SABIO-RK: Biochemical Reaction Kinetics Database

More...
SABIO-RKi
Q99504

SIGNOR Signaling Network Open Resource

More...
SIGNORi
Q99504

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Eyes absent homolog 3 (EC:3.1.3.482 Publications)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:EYA3
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 1

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:3521, EYA3

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
601655, gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q99504

Eukaryotic Pathogen, Vector and Host Database Resources

More...
VEuPathDBi
HostDB:ENSG00000158161

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Keywords - Cellular componenti

Cytoplasm, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi266S → A: Fails to form damage-dependent nuclear foci or interact with H2AX. 1 Publication1
Mutagenesisi309D → A: Loss of tyrosine phosphatase activity toward H2AX. 1 Publication1

Organism-specific databases

DisGeNET

More...
DisGeNETi
2140

Open Targets

More...
OpenTargetsi
ENSG00000158161

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA27933

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q99504, Tbio

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...
ChEMBLi
CHEMBL4296245

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
EYA3

Domain mapping of disease mutations (DMDM)

More...
DMDMi
239938901

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002186481 – 573Eyes absent homolog 3Add BLAST573

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei1N-acetylmethionineCombined sources1
Modified residuei262PhosphoserineCombined sources1
Modified residuei266Phosphoserine1 Publication1
Modified residuei438PhosphoserineCombined sources1
Modified residuei472PhosphoserineCombined sources1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Ser-266 phosphorylation is required for localization at sites of DNA damage and directing interaction with H2AX.1 Publication

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q99504

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q99504

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q99504

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q99504

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q99504

PeptideAtlas

More...
PeptideAtlasi
Q99504

PRoteomics IDEntifications database

More...
PRIDEi
Q99504

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
4324
4738
70790
78305 [Q99504-1]
78306 [Q99504-2]

Consortium for Top Down Proteomics

More...
TopDownProteomicsi
Q99504-2 [Q99504-2]

PTM databases

DEPOD human dephosphorylation database

More...
DEPODi
EYA3

GlyGen: Computational and Informatics Resources for Glycoscience

More...
GlyGeni
Q99504, 3 sites, 2 O-linked glycans (3 sites)

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q99504

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q99504

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000158161, Expressed in kidney epithelium and 214 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q99504, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q99504, HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
ENSG00000158161, Low tissue specificity

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with SIX1 and DACH1, and probably SIX2, SIX4, SIX5.

By similarity

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
108441, 46 interactors

Database of interacting proteins

More...
DIPi
DIP-60448N

Protein interaction database and analysis system

More...
IntActi
Q99504, 19 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000362978

Chemistry databases

BindingDB database of measured binding affinities

More...
BindingDBi
Q99504

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q99504, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q99504

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni1 – 46DisorderedSequence analysisAdd BLAST46
Regioni236 – 296DisorderedSequence analysisAdd BLAST61

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular type of amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi17 – 46Polar residuesSequence analysisAdd BLAST30
Compositional biasi254 – 272Polar residuesSequence analysisAdd BLAST19
Compositional biasi273 – 296Basic and acidic residuesSequence analysisAdd BLAST24

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG3107, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00950000182978

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_021184_2_1_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q99504

Identification of Orthologs from Complete Genome Data

More...
OMAi
LWPGIKT

Database of Orthologous Groups

More...
OrthoDBi
1030296at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q99504

TreeFam database of animal gene trees

More...
TreeFami
TF319337

Family and domain databases

Conserved Domains Database

More...
CDDi
cd02601, HAD_Eya, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
3.40.50.12350, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR028479, EYA3
IPR006545, EYA_dom
IPR042577, EYA_dom_metazoan
IPR038102, EYA_dom_sf
IPR028472, EYA_fam

The PANTHER Classification System

More...
PANTHERi
PTHR10190, PTHR10190, 1 hit
PTHR10190:SF5, PTHR10190:SF5, 1 hit

TIGRFAMs; a protein family database

More...
TIGRFAMsi
TIGR01658, EYA-cons_domain, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (5+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 5 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 5 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: Q99504-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MEEEQDLPEQ PVKKAKMQES GEQTISQVSN PDVSDQKPET SSLASNLPMS
60 70 80 90 100
EEIMTCTDYI PRSSNDYTSQ MYSAKPYAHI LSVPVSETAY PGQTQYQTLQ
110 120 130 140 150
QTQPYAVYPQ ATQTYGLPPF GALWPGMKPE SGLIQTPSPS QHSVLTCTTG
160 170 180 190 200
LTTSQPSPAH YSYPIQASST NASLISTSST IANIPAAAVA SISNQDYPTY
210 220 230 240 250
TILGQNQYQA CYPSSSFGVT GQTNSDAEST TLAATTYQSE KPSVMAPAPA
260 270 280 290 300
AQRLSSGDPS TSPSLSQTTP SKDTDDQSRK NMTSKNRGKR KADATSSQDS
310 320 330 340 350
ELERVFLWDL DETIIIFHSL LTGSYAQKYG KDPTVVIGSG LTMEEMIFEV
360 370 380 390 400
ADTHLFFNDL EECDQVHVED VASDDNGQDL SNYSFSTDGF SGSGGSGSHG
410 420 430 440 450
SSVGVQGGVD WMRKLAFRYR KVREIYDKHK SNVGGLLSPQ RKEALQRLRA
460 470 480 490 500
EIEVLTDSWL GTALKSLLLI QSRKNCVNVL ITTTQLVPAL AKVLLYGLGE
510 520 530 540 550
IFPIENIYSA TKIGKESCFE RIVSRFGKKV TYVVIGDGRD EEIAAKQHNM
560 570
PFWRITNHGD LVSLHQALEL DFL
Length:573
Mass (Da):62,663
Last modified:June 16, 2009 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i684B961B1E630371
GO
Isoform 2 (identifier: Q99504-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-126: Missing.

Show »
Length:447
Mass (Da):48,652
Checksum:i129E0A20B4A7BA2F
GO
Isoform 3 (identifier: Q99504-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     121-166: Missing.
     548-572: HNMPFWRITNHGDLVSLHQALELDF → QLYFLDMEALGCQLEPTALILFIQLSGNLSNYNK

Show »
Length:536
Mass (Da):58,697
Checksum:i7F502740058138F7
GO
Isoform 4 (identifier: Q99504-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-53: Missing.

Show »
Length:520
Mass (Da):56,805
Checksum:iEE85E9F3F4E00708
GO
Isoform 5 (identifier: Q99504-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     121-166: Missing.

Show »
Length:527
Mass (Da):57,827
Checksum:i33DA17379017618E
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
B1APR7B1APR7_HUMAN
Eyes absent homolog
EYA3
416Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti105Y → D in CAA71311 (PubMed:9020840).Curated1
Sequence conflicti142H → R in AAB42066 (PubMed:9049631).Curated1
Sequence conflicti151L → V in AAB42066 (PubMed:9049631).Curated1
Sequence conflicti253R → K in CAA71311 (PubMed:9020840).Curated1
Sequence conflicti268T → S in AAB42066 (PubMed:9049631).Curated1
Sequence conflicti283T → N in CAA71311 (PubMed:9020840).Curated1
Sequence conflicti290R → K in CAA71311 (PubMed:9020840).Curated1
Sequence conflicti305V → L in AAB42066 (PubMed:9049631).Curated1
Sequence conflicti345E → K in CAA71311 (PubMed:9020840).Curated1
Sequence conflicti357F → S in CAA71311 (PubMed:9020840).Curated1
Sequence conflicti361E → K in CAA71311 (PubMed:9020840).Curated1
Sequence conflicti373 – 381SDDNGQDLS → PNDKGQNLN in CAA71311 (PubMed:9020840).Curated9
Sequence conflicti388D → N in CAA71311 (PubMed:9020840).Curated1
Sequence conflicti447 – 449RLR → KLK in CAA71311 (PubMed:9020840).Curated3
Sequence conflicti457D → N in CAA71311 (PubMed:9020840).Curated1
Sequence conflicti473R → K in CAA71311 (PubMed:9020840).Curated1
Sequence conflicti480L → P in AAB42066 (PubMed:9049631).Curated1
Sequence conflicti487V → L in CAA71311 (PubMed:9020840).Curated1
Sequence conflicti500E → K in CAA71311 (PubMed:9020840).Curated1
Sequence conflicti524 – 526SRF → TSL in CAA71311 (PubMed:9020840).Curated3
Sequence conflicti530V → L in CAA71311 (PubMed:9020840).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0014931 – 126Missing in isoform 2. 1 PublicationAdd BLAST126
Alternative sequenceiVSP_0545301 – 53Missing in isoform 4. 1 PublicationAdd BLAST53
Alternative sequenceiVSP_054518121 – 166Missing in isoform 3 and isoform 5. 2 PublicationsAdd BLAST46
Alternative sequenceiVSP_054519548 – 572HNMPF…LELDF → QLYFLDMEALGCQLEPTALI LFIQLSGNLSNYNK in isoform 3. 1 PublicationAdd BLAST25

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
Y10262 Genomic DNA Translation: CAA71311.1
U81602 mRNA Translation: AAB42066.1
AK289805 mRNA Translation: BAF82494.1
AK295745 mRNA Translation: BAG58579.1
AK298129 mRNA Translation: BAG60409.1
AL137792 Genomic DNA No translation available.
AL512288 Genomic DNA No translation available.
CH471059 Genomic DNA Translation: EAX07713.1
CH471059 Genomic DNA Translation: EAX07714.1
BC041667 mRNA Translation: AAH41667.1
AJ007991 mRNA Translation: CAA07814.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS316.1 [Q99504-1]
CCDS60050.1 [Q99504-4]
CCDS60051.1 [Q99504-5]
CCDS60052.1 [Q99504-3]

NCBI Reference Sequences

More...
RefSeqi
NP_001269489.1, NM_001282560.1 [Q99504-3]
NP_001269490.1, NM_001282561.1 [Q99504-5]
NP_001269491.1, NM_001282562.1 [Q99504-4]
NP_001981.2, NM_001990.3 [Q99504-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000373863; ENSP00000362970; ENSG00000158161 [Q99504-3]
ENST00000373871; ENSP00000362978; ENSG00000158161 [Q99504-1]
ENST00000436342; ENSP00000405587; ENSG00000158161 [Q99504-4]
ENST00000540618; ENSP00000442558; ENSG00000158161 [Q99504-5]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
2140

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:2140

UCSC genome browser

More...
UCSCi
uc001bpi.3, human [Q99504-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
Y10262 Genomic DNA Translation: CAA71311.1
U81602 mRNA Translation: AAB42066.1
AK289805 mRNA Translation: BAF82494.1
AK295745 mRNA Translation: BAG58579.1
AK298129 mRNA Translation: BAG60409.1
AL137792 Genomic DNA No translation available.
AL512288 Genomic DNA No translation available.
CH471059 Genomic DNA Translation: EAX07713.1
CH471059 Genomic DNA Translation: EAX07714.1
BC041667 mRNA Translation: AAH41667.1
AJ007991 mRNA Translation: CAA07814.1
CCDSiCCDS316.1 [Q99504-1]
CCDS60050.1 [Q99504-4]
CCDS60051.1 [Q99504-5]
CCDS60052.1 [Q99504-3]
RefSeqiNP_001269489.1, NM_001282560.1 [Q99504-3]
NP_001269490.1, NM_001282561.1 [Q99504-5]
NP_001269491.1, NM_001282562.1 [Q99504-4]
NP_001981.2, NM_001990.3 [Q99504-1]

3D structure databases

SMRiQ99504
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi108441, 46 interactors
DIPiDIP-60448N
IntActiQ99504, 19 interactors
STRINGi9606.ENSP00000362978

Chemistry databases

BindingDBiQ99504
ChEMBLiCHEMBL4296245

PTM databases

DEPODiEYA3
GlyGeniQ99504, 3 sites, 2 O-linked glycans (3 sites)
iPTMnetiQ99504
PhosphoSitePlusiQ99504

Genetic variation databases

BioMutaiEYA3
DMDMi239938901

Proteomic databases

EPDiQ99504
jPOSTiQ99504
MassIVEiQ99504
MaxQBiQ99504
PaxDbiQ99504
PeptideAtlasiQ99504
PRIDEiQ99504
ProteomicsDBi4324
4738
70790
78305 [Q99504-1]
78306 [Q99504-2]
TopDownProteomicsiQ99504-2 [Q99504-2]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
16480, 156 antibodies

The DNASU plasmid repository

More...
DNASUi
2140

Genome annotation databases

EnsembliENST00000373863; ENSP00000362970; ENSG00000158161 [Q99504-3]
ENST00000373871; ENSP00000362978; ENSG00000158161 [Q99504-1]
ENST00000436342; ENSP00000405587; ENSG00000158161 [Q99504-4]
ENST00000540618; ENSP00000442558; ENSG00000158161 [Q99504-5]
GeneIDi2140
KEGGihsa:2140
UCSCiuc001bpi.3, human [Q99504-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
2140
DisGeNETi2140

GeneCards: human genes, protein and diseases

More...
GeneCardsi
EYA3
HGNCiHGNC:3521, EYA3
HPAiENSG00000158161, Low tissue specificity
MIMi601655, gene
neXtProtiNX_Q99504
OpenTargetsiENSG00000158161
PharmGKBiPA27933
VEuPathDBiHostDB:ENSG00000158161

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG3107, Eukaryota
GeneTreeiENSGT00950000182978
HOGENOMiCLU_021184_2_1_1
InParanoidiQ99504
OMAiLWPGIKT
OrthoDBi1030296at2759
PhylomeDBiQ99504
TreeFamiTF319337

Enzyme and pathway databases

PathwayCommonsiQ99504
ReactomeiR-HSA-5693565, Recruitment and ATM-mediated phosphorylation of repair and signaling proteins at DNA double strand breaks
SABIO-RKiQ99504
SIGNORiQ99504

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
2140, 5 hits in 1024 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
EYA3, human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
2140
PharosiQ99504, Tbio

Protein Ontology

More...
PROi
PR:Q99504
RNActiQ99504, protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000158161, Expressed in kidney epithelium and 214 other tissues
ExpressionAtlasiQ99504, baseline and differential
GenevisibleiQ99504, HS

Family and domain databases

CDDicd02601, HAD_Eya, 1 hit
Gene3Di3.40.50.12350, 1 hit
InterProiView protein in InterPro
IPR028479, EYA3
IPR006545, EYA_dom
IPR042577, EYA_dom_metazoan
IPR038102, EYA_dom_sf
IPR028472, EYA_fam
PANTHERiPTHR10190, PTHR10190, 1 hit
PTHR10190:SF5, PTHR10190:SF5, 1 hit
TIGRFAMsiTIGR01658, EYA-cons_domain, 1 hit

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiEYA3_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q99504
Secondary accession number(s): A8K190
, B4DIR7, B4DNZ7, O95463, Q8IVX7, Q99813
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 15, 1998
Last sequence update: June 16, 2009
Last modified: September 29, 2021
This is version 180 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again